KEGG   Paenibacillus mucilaginosus K02: B2K_35865Help
Entry
B2K_35865         CDS       T02041                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B2K_35865
Enzymes [BR:pmw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     B2K_35865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8423033..8423884)
Genome map
AA seq 283 aa AA seqDB search
METSERGRSSDTTSVLEREFPGRDKRTLIMGILNVTPDSFSDGGRYIDPASAVERAKQML
EEGADILDIGGESTRPGFAPVPLEEELRRVLPAIRAIREAGIKVPISIDTYKAETARQAL
EAGATWLNDIWCLQKDEAMARIAAEYAAPIVLMHNRTEPVYANFIQDVVDDLQRTVERAR
AAGIAEEQIILDPGIGFAKTYEQNLQLMNHLERIVGLGFPVLLGTSRKRMIHQTLQLPPH
DVVEGTAATVALGVAQGCRIMRVHDVRAMRRVADMTDAIIRQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggagacttcagagcgtggacgcagcagcgatacaacatccgtcttggagcgtgaattt
ccgggcagggataagcgtacccttattatgggaatcctgaatgtcaccccggattcgttc
tcggacgggggacggtatatcgacccggcgtctgccgtggaacgggcgaagcagatgctc
gaagaaggagccgatatcctggatatcggaggcgagtcgacaagacccggcttcgcaccg
gttccgctggaggaagagctgcggcgtgtgctgcctgccattcgtgcaatccgggaggcg
ggcattaaggttcctatctccattgatacatacaaggcggagacggcccggcaggctttg
gaggccggggccacttggctcaatgatatttggtgcctccaaaaggatgaggctatggcg
cggattgccgccgaatatgcggctcctatcgtgctgatgcataatcggaccgagccggtg
tatgctaactttatccaggacgtagtggacgatctgcagcggaccgtggaacgggcgagg
gccgcagggattgcggaggagcagatcattctcgatccggggatcggttttgccaagacg
tacgagcagaaccttcagctgatgaaccacctggagcgtattgtcgggctcggctttccg
gtgcttctcggcacgtcgcgcaagaggatgatccaccagacgctgcagcttccaccgcac
gacgtagtggaaggaaccgctgctacggtcgcccttggggttgcccaaggctgccggatt
atgcgggtgcatgatgtacgtgccatgcgccgggtggcggatatgaccgatgcgatcatc
aggcagagataa

DBGET integrated database retrieval system