KEGG   Paenibacillus mucilaginosus K02: B2K_36170Help
Entry
B2K_36170         CDS       T02041                                 

Definition
recombinase RecR
Orthology
K06187  
recombination protein RecR
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B2K_36170
DNA repair and recombination proteins [BR:pmw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      B2K_36170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8486475..8487071)
Genome map
AA seq 198 aa AA seqDB search
MYYPEPLARLIDSFSRLPGIGPKTAGRLAFHVLRMKEEDVIDFAKALVNVKRNLHYCSVC
CNITDTDPCRICQDKTRDGSVICVIQEPKDLVAMERTKEFNGYYHVLHGAISPMEGIGPD
ELRIPDLLRRLSDEKVQELILATNPNIEGEATAMYLSRLVRPFGLKVTRIAHGLPVGGDL
EYADEVTLTKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgtattatcccgaaccgttagcccgattgattgattcgttctcgcgcctgcccggtatc
gggcccaaaacggcagggcgacttgcatttcatgtgctccgcatgaaggaagaggatgtt
attgattttgccaaagcgctggtgaatgtgaagcggaatctccattactgctcggtatgc
tgcaatattaccgataccgatccttgccggatctgtcaggataagacccgtgacggttcg
gtcatctgtgtgattcaggagcccaaggatctcgtggcgatggaacgcaccaaggagttt
aatggatattaccacgtgctccacggagcgatctctcctatggaggggattggtcccgat
gaactgcggattcccgatctgctccgccgcctgagtgatgagaaggtgcaggagctgatt
ctggcgacgaacccgaacatcgaaggggaggctacagccatgtatttgtccaggctggtc
cgcccgtttggtctgaaagtcacacggattgcgcatggtctgccggtcggcggcgatctg
gagtatgcggacgaagtgacgctgaccaaagccctggaaggaagaagagagctgtaa

DBGET integrated database retrieval system