KEGG   Persephonella marina: PERMA_0257Help
Entry
PERMA_0257        CDS       T00870                                 

Gene name
thrC_2
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmx  Persephonella marina
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmx01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pmx00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pmx00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231364..232434
Genome map
AA seq 356 aa AA seqDB search
MDNCKWRGIITAYREFLPVTDKTPVVTLYEGNTPLIDAPNLSKKIAPDKDLKIYLKYEGL
NPTGSFKDRGMTMAISKAKESGKTAVICASTGNTSASAAAYAARAGMDAYVILPKGAVAL
GKLSQAMVYGAKIIALMGNFDDALSIVREIGEKYPVEVVNSVNPYRIEGQKTASFEIIDA
LGDAPDYHFIPVGNAGNITAYWKGYKEYKEAGRSTKLPRMIGWQAEGAAPIVKGFPIKNP
QTIATAIKIGNPYSWQPALQAAKESNGFIDAVSDEEILEAYRLVASTEGVFCEPASAASV
AGVIKAYRKGLFKGGETVVCTLTGNGLKDPDTVIKASEKPVEMPPDINEIARYLGL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttggacaactgtaaatggagagggataatcaccgcatacagagaatttttacctgtaacc
gataaaacccctgttgtaacactgtacgaaggaaacacaccactcatagatgctccaaac
ctctcaaaaaagatagctcctgacaaggatcttaagatatatctgaagtatgaaggactt
aacccaacaggatcatttaaagatcgtggaatgacgatggccatatcaaaggctaaagag
tctggaaagacagccgttatatgtgcatcaacaggaaacacatctgcatctgcagctgcc
tatgctgcaagggctggtatggatgcttatgtaatacttcctaagggtgccgttgccctt
ggaaaactctctcaggctatggtttacggtgcaaagattatagccctgatgggaaatttt
gacgatgctctgagtatagtgagagagattggggaaaagtatcctgtagaggttgttaac
tctgtaaatccttacaggattgaaggacagaaaacagcaagttttgagattatagatgct
cttggtgatgctccagactaccactttatacctgtgggaaatgcaggaaatataacagct
tactggaaaggttacaaagagtataaagaggcaggcagatcaacaaaacttccaagaatg
ataggatggcaggctgaaggtgctgctcctatagtgaaaggttttcccataaagaatcca
cagacgattgcaacagcgataaagataggaaatccttacagctggcagcctgcacttcag
gcggcaaaggagagcaacggctttattgatgctgtttctgatgaggagatacttgaggct
tacagacttgttgcctcaactgaaggtgttttctgtgaacctgcatctgcagcatcggtt
gcaggtgttataaaggcatacagaaaaggtctttttaaaggtggagaaactgtagtgtgt
acacttacgggtaacggtcttaaagatcctgacacagttataaaggcaagtgaaaagcct
gtagagatgccaccggacataaatgagatagcaagatatttaggactatga

DBGET integrated database retrieval system