KEGG   Persephonella marina: PERMA_0257Help
Entry
PERMA_0257        CDS       T00870                                 

Gene name
thrC_2
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmx  Persephonella marina
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PERMA_0257 (thrC_2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PERMA_0257 (thrC_2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PERMA_0257 (thrC_2)
Enzymes [BR:pmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PERMA_0257 (thrC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231364..232434
Genome map
AA seq 356 aa AA seqDB search
MDNCKWRGIITAYREFLPVTDKTPVVTLYEGNTPLIDAPNLSKKIAPDKDLKIYLKYEGL
NPTGSFKDRGMTMAISKAKESGKTAVICASTGNTSASAAAYAARAGMDAYVILPKGAVAL
GKLSQAMVYGAKIIALMGNFDDALSIVREIGEKYPVEVVNSVNPYRIEGQKTASFEIIDA
LGDAPDYHFIPVGNAGNITAYWKGYKEYKEAGRSTKLPRMIGWQAEGAAPIVKGFPIKNP
QTIATAIKIGNPYSWQPALQAAKESNGFIDAVSDEEILEAYRLVASTEGVFCEPASAASV
AGVIKAYRKGLFKGGETVVCTLTGNGLKDPDTVIKASEKPVEMPPDINEIARYLGL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttggacaactgtaaatggagagggataatcaccgcatacagagaatttttacctgtaacc
gataaaacccctgttgtaacactgtacgaaggaaacacaccactcatagatgctccaaac
ctctcaaaaaagatagctcctgacaaggatcttaagatatatctgaagtatgaaggactt
aacccaacaggatcatttaaagatcgtggaatgacgatggccatatcaaaggctaaagag
tctggaaagacagccgttatatgtgcatcaacaggaaacacatctgcatctgcagctgcc
tatgctgcaagggctggtatggatgcttatgtaatacttcctaagggtgccgttgccctt
ggaaaactctctcaggctatggtttacggtgcaaagattatagccctgatgggaaatttt
gacgatgctctgagtatagtgagagagattggggaaaagtatcctgtagaggttgttaac
tctgtaaatccttacaggattgaaggacagaaaacagcaagttttgagattatagatgct
cttggtgatgctccagactaccactttatacctgtgggaaatgcaggaaatataacagct
tactggaaaggttacaaagagtataaagaggcaggcagatcaacaaaacttccaagaatg
ataggatggcaggctgaaggtgctgctcctatagtgaaaggttttcccataaagaatcca
cagacgattgcaacagcgataaagataggaaatccttacagctggcagcctgcacttcag
gcggcaaaggagagcaacggctttattgatgctgtttctgatgaggagatacttgaggct
tacagacttgttgcctcaactgaaggtgttttctgtgaacctgcatctgcagcatcggtt
gcaggtgttataaaggcatacagaaaaggtctttttaaaggtggagaaactgtagtgtgt
acacttacgggtaacggtcttaaagatcctgacacagttataaaggcaagtgaaaagcct
gtagagatgccaccggacataaatgagatagcaagatatttaggactatga

DBGET integrated database retrieval system