KEGG   Persephonella marina: PERMA_0323Help
Entry
PERMA_0323        CDS       T00870                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pmx  Persephonella marina
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PERMA_0323
Enzymes [BR:pmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PERMA_0323
    3.5.1.-  
     PERMA_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296184..296768
Genome map
AA seq 194 aa AA seqDB search
MRINITDFDALIIVDMQNDFMPGGALPVPDGDKIVDSLNRYIDLFSQKGSPVYFTRDWHP
EDHISFKGYGGIWPPHCVQNTEGAQFHPELKIPSDNKFIISKGVSREFDAYSGFQGTVLD
DLLKERGIKRIFVGGVATDYCVKNTVLGGLNLGYQVFVLEDGIKGVDVNEGDSERAVEVM
KNKGAVIINAEDIR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaggataaatatcacagattttgatgcccttattatagtggatatgcagaatgatttt
atgcccgggggagcgttacctgttcctgacggggataagatcgttgattctcttaacagg
tatatagatcttttttcacagaaaggaagccctgtttactttacaagggactggcatcca
gaagatcatatatccttcaaagggtacggtggaatatggcctccccactgtgttcagaac
actgaaggggcacagtttcatccagaactgaagataccatctgataacaaatttataatc
tcaaagggagtttcaagggagtttgatgcttactcaggttttcagggaactgtgcttgat
gatcttctaaaggagaggggaataaagaggatatttgttgggggtgtggcaacagattac
tgtgttaaaaataccgttttaggtggtctgaatttaggttatcaggtctttgttcttgaa
gatggtataaaaggtgttgatgtaaatgagggagacagtgagagggctgtagaagttatg
aaaaataaaggcgcagtcattataaatgctgaggatataagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system