KEGG   Persephonella marina: PERMA_0343Help
Entry
PERMA_0343        CDS       T00870                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K22305  
phosphoserine phosphatase [EC:3.1.3.3]
Organism
pmx  Persephonella marina
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    PERMA_0343
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PERMA_0343
Enzymes [BR:pmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     PERMA_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
313436..314074
Genome map
AA seq 212 aa AA seqDB search
MAVRIIYVRHAESLWNPIGKYQGRLDPELSERGHKQAELLAKILKKYEPSALYSSPLKRT
YMTAEYISKELDLPINIDEDIIEIDHGEWSGMLVEEVKEKYPDLFRQWLYEPETIKFPHG
ETLIDVYNRVKRFQERMLEKHEGETIIAVSHTVPIRASFVAGLDLPLAKFWSFGCDNASY
SILDYEKVRPILYKLNNTYFLGDLFIPALDAL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaggattatatatgtgagacatgcagagagcctgtggaaccctataggaaag
tatcagggaagacttgatcccgagctgagcgaaagaggtcacaaacaggctgaacttcta
gcgaagatactgaaaaaatacgaaccatcagcactttactcaagccctttaaaaagaact
tatatgacagctgagtacatatctaaggagcttgatcttccaataaatatagatgaggat
attatagagatagaccacggtgagtggtctggaatgcttgttgaagaggttaaggaaaaa
taccctgatctattcagacagtggctttatgaacctgaaacgataaaattcccacatggg
gaaacacttatagatgtttacaacagggtaaaaaggtttcaggagagaatgcttgagaaa
catgagggtgagaccatcatagctgtttctcatacagttcctataagagcttcatttgtg
gcaggacttgatcttccacttgctaagttctggagttttgggtgtgataacgcttcatac
tcaatactagattatgagaaggtaagacctattctttacaaacttaacaacacatacttt
ttaggtgacctttttatacctgctttagatgcactttaa

DBGET integrated database retrieval system