KEGG   Persephonella marina: PERMA_0343Help
Entry
PERMA_0343        CDS       T00870                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
pmx  Persephonella marina
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PERMA_0343
   01230 Biosynthesis of amino acids
    PERMA_0343
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PERMA_0343
  Energy metabolism
   00680 Methane metabolism
    PERMA_0343
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PERMA_0343
Enzymes [BR:pmx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     PERMA_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313436..314074
Genome map
AA seq 212 aa AA seqDB search
MAVRIIYVRHAESLWNPIGKYQGRLDPELSERGHKQAELLAKILKKYEPSALYSSPLKRT
YMTAEYISKELDLPINIDEDIIEIDHGEWSGMLVEEVKEKYPDLFRQWLYEPETIKFPHG
ETLIDVYNRVKRFQERMLEKHEGETIIAVSHTVPIRASFVAGLDLPLAKFWSFGCDNASY
SILDYEKVRPILYKLNNTYFLGDLFIPALDAL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaggattatatatgtgagacatgcagagagcctgtggaaccctataggaaag
tatcagggaagacttgatcccgagctgagcgaaagaggtcacaaacaggctgaacttcta
gcgaagatactgaaaaaatacgaaccatcagcactttactcaagccctttaaaaagaact
tatatgacagctgagtacatatctaaggagcttgatcttccaataaatatagatgaggat
attatagagatagaccacggtgagtggtctggaatgcttgttgaagaggttaaggaaaaa
taccctgatctattcagacagtggctttatgaacctgaaacgataaaattcccacatggg
gaaacacttatagatgtttacaacagggtaaaaaggtttcaggagagaatgcttgagaaa
catgagggtgagaccatcatagctgtttctcatacagttcctataagagcttcatttgtg
gcaggacttgatcttccacttgctaagttctggagttttgggtgtgataacgcttcatac
tcaatactagattatgagaaggtaagacctattctttacaaacttaacaacacatacttt
ttaggtgacctttttatacctgctttagatgcactttaa

DBGET integrated database retrieval system