KEGG   Persephonella marina: PERMA_0343Help
Entry
PERMA_0343        CDS       T00870                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K22305  phosphoserine phosphatase [EC:3.1.3.3]
Organism
pmx  Persephonella marina
Pathway
pmx00260  Glycine, serine and threonine metabolism
pmx00680  Methane metabolism
pmx01100  Metabolic pathways
pmx01120  Microbial metabolism in diverse environments
pmx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    PERMA_0343
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PERMA_0343
Enzymes [BR:pmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     PERMA_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACO03386
UniProt: C0QTX1
Position
313436..314074
Genome map
AA seq 212 aa AA seqDB search
MAVRIIYVRHAESLWNPIGKYQGRLDPELSERGHKQAELLAKILKKYEPSALYSSPLKRT
YMTAEYISKELDLPINIDEDIIEIDHGEWSGMLVEEVKEKYPDLFRQWLYEPETIKFPHG
ETLIDVYNRVKRFQERMLEKHEGETIIAVSHTVPIRASFVAGLDLPLAKFWSFGCDNASY
SILDYEKVRPILYKLNNTYFLGDLFIPALDAL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaggattatatatgtgagacatgcagagagcctgtggaaccctataggaaag
tatcagggaagacttgatcccgagctgagcgaaagaggtcacaaacaggctgaacttcta
gcgaagatactgaaaaaatacgaaccatcagcactttactcaagccctttaaaaagaact
tatatgacagctgagtacatatctaaggagcttgatcttccaataaatatagatgaggat
attatagagatagaccacggtgagtggtctggaatgcttgttgaagaggttaaggaaaaa
taccctgatctattcagacagtggctttatgaacctgaaacgataaaattcccacatggg
gaaacacttatagatgtttacaacagggtaaaaaggtttcaggagagaatgcttgagaaa
catgagggtgagaccatcatagctgtttctcatacagttcctataagagcttcatttgtg
gcaggacttgatcttccacttgctaagttctggagttttgggtgtgataacgcttcatac
tcaatactagattatgagaaggtaagacctattctttacaaacttaacaacacatacttt
ttaggtgacctttttatacctgctttagatgcactttaa

DBGET integrated database retrieval system