KEGG   Persephonella marina: PERMA_0386Help
Entry
PERMA_0386        CDS       T00870                                 

Definition
(GenBank) cytochrome c551 peroxidase (Cytochrome cperoxidase)
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
pmx  Persephonella marina
Brite
Enzymes [BR:pmx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PERMA_0386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DUF1924
Motif
Other DBs
NCBI-ProteinID: ACO03166
UniProt: C0QU12
Position
complement(348561..349481)
Genome map
AA seq 306 aa AA seqDB search
MVLIKLSYGIEPIQPIPIRIEYNREKAELGKILFHDPILSRDRSVSCASCHDVYEKWGTD
HRKASVGVGGKVGNVNAPTVFNTFFNFRQFWNGRAKNLKEQVEGPIHNPIEMGMSKREIE
KRLNSIPFYRKMFKKIYNADRITYDIVIDAIVEFEKALITPNSKFDRYLRGEVKLSKEEK
EGYMLFKKFGCITCHNGINVGGNSFQKIGAIKPFPWSPENPDRYQLTKREFDKNRYKVPS
LRNIECTYPYFHDGSVQTLEDAIRTMAYHNLGFKLSEEEVRKIVAFLKTLTGELPEILKK
DLKDRR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttggtcttaataaaactgtcgtatgggattgaacctatacagcctataccaatacgtatt
gagtacaatagagagaaagccgagctcggtaagatactgttccacgaccctatactatca
agggacaggtctgtatcctgtgcatcatgccatgatgtttacgaaaaatggggaaccgat
catagaaaagcctctgttggggttggggggaaggttggtaacgttaacgctccaacagtt
ttcaacacatttttcaatttcagacagttctggaacggaagggcaaagaatctaaaagag
caggttgaaggccctatacataatcccattgagatgggaatgagcaaaagggagatagag
aaaagactgaacagtattcccttttacagaaaaatgtttaaaaagatttataatgcagac
agaataacttacgatatagttattgatgcgatagttgagtttgagaaggctttgataaca
ccgaacagcaagtttgatagatatctcagaggtgaggtaaaactttcaaaagaggaaaaa
gaagggtacatgctttttaaaaagtttggatgtataacatgtcataacggtataaatgtt
ggtgggaactcctttcagaagataggagctataaaacctttcccgtggagtccagaaaac
ccagacagatatcagctaacaaaaagagagtttgataaaaacaggtataaggttccttca
ctgagaaatatagagtgtacatacccttacttccatgatggtagtgtccagacccttgag
gatgctatcagaacaatggcataccataatctcggttttaaactatcggaagaggaggta
agaaagatagtagcatttctcaaaacactaacaggcgaacttcctgagattctcaaaaaa
gatctcaaggacagaagatga

DBGET integrated database retrieval system