KEGG   Persephonella marina: PERMA_0528Help
Entry
PERMA_0528        CDS       T00870                                 

Definition
(GenBank) pyruvate synthase subunit PorB (Pyruvate oxidoreductasebeta chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit beta)
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pmx  Persephonella marina
Pathway
pmx00010  Glycolysis / Gluconeogenesis
pmx00020  Citrate cycle (TCA cycle)
pmx00620  Pyruvate metabolism
pmx00633  Nitrotoluene degradation
pmx00640  Propanoate metabolism
pmx00650  Butanoate metabolism
pmx00680  Methane metabolism
pmx00720  Carbon fixation pathways in prokaryotes
pmx01100  Metabolic pathways
pmx01120  Microbial metabolism in diverse environments
pmx01130  Biosynthesis of antibiotics
pmx01200  Carbon metabolism
Module
pmx_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
pmx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PERMA_0528
   00020 Citrate cycle (TCA cycle)
    PERMA_0528
   00620 Pyruvate metabolism
    PERMA_0528
   00640 Propanoate metabolism
    PERMA_0528
   00650 Butanoate metabolism
    PERMA_0528
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PERMA_0528
   00680 Methane metabolism
    PERMA_0528
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PERMA_0528
Enzymes [BR:pmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PERMA_0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACO03514
UniProt: C0QUF2
Position
complement(478024..479046)
Genome map
AA seq 340 aa AA seqDB search
MAKKRPIALLSELASHKETFGGDMPIAPGHRMCIGCGIPPIVNEILLAINKPVIVSNATG
CLEVTTGVYPVTAWNVPWIHVNFQSAATVITGVESAYKVLKKKGVLPEDLDIEFVAFGGD
GGTYDIGFQSLSASVERGHNFLYVCYNNEGYQNTGYQKSSATPIGAYTKTTPVGKERVGK
QEPRKDLTMIMAAHGIPYVAQASPHIFRDLTRKTKKAMTFKGPKFINVLEPCTLSWRFSP
DDTMRLAKLAVETRYWPVYEVIHGKYWKVNIKPKRPKPIEEYIAAQPRWKHVLKYPEVLE
RIQKEIDEKWNLLLHLEEMSKKLAEDEGIDYEELFKVPED
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagagacctatagcactactttcagaacttgcatcacataaagagactttt
ggcggtgatatgccaatagcaccgggacacagaatgtgtatcggttgcggtatcccacct
attgtaaatgagatactacttgcgataaacaaacctgttatcgtttcaaacgcaactggc
tgtcttgaggttacaacaggtgtttaccctgttactgcatggaacgttccgtggattcat
gttaacttccagtctgctgcaactgttataacaggggttgaatcagcatacaaggttcta
aagaaaaaaggagtactaccggaagatctagatattgagtttgtagcatttggtggagac
ggaggaacatacgacataggatttcagtctctatctgcatctgtggaaagaggtcacaac
ttcctctatgtatgctacaacaacgaaggttaccagaacacaggttaccagaagtcctca
gcaacacctataggtgcatacacaaaaacaacacctgtaggtaaagaaagggttggaaaa
caggagccaagaaaggatcttaccatgatcatggcggctcacggaatcccttacgttgcc
caggcttcccctcatatattcagagatcttacaagaaaaacaaaaaaagctatgacattc
aaaggacctaaatttataaatgtacttgagccgtgtacactttcatggagattctctcca
gatgatacaatgaggctggccaagcttgctgttgaaacaagatactggcctgtttacgag
gttatccatggaaagtactggaaagttaatataaaaccaaaaagacctaagcctatagag
gagtatatagctgcacagcctagatggaagcatgttctcaagtatcctgaagtactggaa
agaatacagaaagagatagatgaaaagtggaacctacttctccaccttgaggagatgtcc
aaaaagttagctgaagatgaaggtatagattacgaggagcttttcaaagttcctgaagat
taa

DBGET integrated database retrieval system