KEGG   Persephonella marina: PERMA_0529Help
Entry
PERMA_0529        CDS       T00870                                 

Definition
pyruvate synthase subunit PorA (Pyruvate oxidoreductasealpha chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit alpha) (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pmx  Persephonella marina
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PERMA_0529
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PERMA_0529
   00020 Citrate cycle (TCA cycle)
    PERMA_0529
   00620 Pyruvate metabolism
    PERMA_0529
   00640 Propanoate metabolism
    PERMA_0529
   00650 Butanoate metabolism
    PERMA_0529
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PERMA_0529
   00680 Methane metabolism
    PERMA_0529
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PERMA_0529
Enzymes [BR:pmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PERMA_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(479049..480242)
Genome map
AA seq 397 aa AA seqDB search
MAQTKVVALTGNQAAAEAMRQINFDIAAVYPISPQTELMGFFAEYVANGEVDTEMIAVDG
EHSAMATCIGAAAAGARTITASAGPGIAYMVENLYVASGMRVPIVLLDVNRALSAPLSIH
CDHADSMLTRDTGWISIFCENAQEAYHSIIMSVKISEKAMFPIIVNYDGYIVSHSIEDVE
ILDDETVRNFVGPSDIHRIPHPLLDIKNPVTYGATAQPDYYTECKYQQHVDFLKVYDVVR
EVFEEFGQIVGRKYDFIEEYKTEDAEYIGISMGSSFGTLKDTVDTLREQGKKVGAIKIRL
YRPFPVKEIAKALSNAKGVAVLDRADSFDGIGGPLFKDVASALLGTTNRPFVHNFIYGLG
GREVLEEDFIKAFNRLERLEKGIETRENFVEYLQVRE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaacaaaagttgttgctttaacaggtaaccaggctgctgcagaggctatgaga
cagataaactttgatattgcagcagtttatcctatatcaccacagacagaacttatggga
ttttttgcagagtacgttgcaaacggtgaagttgacacagagatgatagctgttgatggt
gagcactcagctatggccacatgtataggggcagctgctgcaggtgcaagaacgataaca
gcatcagctggaccgggtatagcctatatggttgaaaacctttatgtcgcatctggaatg
agggtccctatagtattacttgatgttaacagagctctttctgcacctctctcaatccac
tgtgaccatgcagactcaatgcttacaagggatacaggctggatctcaatattctgtgaa
aacgcacaggaagcgtaccactcaatcatcatgtcagttaagatatctgaaaaggctatg
ttcccgataatagttaactatgatggatatatagtttcacactctattgaggatgttgag
atacttgatgatgagactgtaagaaactttgttggaccttctgatatacacagaattcct
cacccacttttagatatcaaaaatcctgtaacatacggagccacagcacaacctgactac
tacacagagtgtaaataccagcagcatgttgactttctaaaggtttacgatgttgttaga
gaggtttttgaggagtttggacagatagtaggaaggaagtatgactttatagaggagtat
aaaactgaggatgctgagtatataggaatttcaatgggatcttcatttggaacacttaaa
gatactgtagatacattaagagaacagggtaaaaaggttggagcaataaaaatcagactc
tacagacctttccctgtaaaagagatcgcaaaggctctctccaatgcaaaaggtgttgct
gttttagatagagccgactcatttgatggtattggcggtcctttattcaaggatgttgca
tctgcattacttggaacaacaaatagaccttttgttcacaactttatatacggcttaggt
ggaagagaggttcttgaagaggactttataaaggcatttaacaggcttgaacgccttgag
aaaggcatagaaacgagagaaaactttgttgaatacttacaagtgagggagtaa

DBGET integrated database retrieval system