KEGG   Persephonella marina: PERMA_0530Help
Entry
PERMA_0530        CDS       T00870                                 

Definition
pyruvate synthase subunit PorD (Pyruvate oxidoreductasedelta chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit delta) (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pmx  Persephonella marina
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:pmx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmx00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pmx00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pmx00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pmx00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:pmx00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:pmx00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:pmx00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(480262..480579)
Genome map
AA seq 105 aa AA seqDB search
MSYELKPWHEIPIGSIVTEAGSSKINHTGSWRMLRPVLHTDKCTHCLICWIFCPDDSIPV
TPQERFETDFEYCKGCGICATECPYDALEMVPEMEIKLKELEELG
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgaacttaaaccatggcatgagatacctataggttcaatagttacagaagca
ggatccagtaagataaatcacacaggatcatggagaatgctcagacctgttttacataca
gataaatgtacacactgccttatctgctggatcttctgtcctgacgactcaattcctgta
acacctcaggagagatttgagacggattttgagtactgtaaaggatgtggaatatgtgct
acagaatgtccttacgatgctcttgagatggttccagaaatggaaatcaaactaaaagaa
cttgaagaattaggctaa

DBGET integrated database retrieval system