KEGG   Persephonella marina: PERMA_0532Help
Entry
PERMA_0532        CDS       T00870                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmx  Persephonella marina
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(481329..481937)
Genome map
AA seq 202 aa AA seqDB search
MKDIDIIPSTLKEAVEKISELPGYGEKSAKRFAVNLLDMPRGEAIQIIKTLFDMLEKIHP
CSECGLYTEEEICSICSSEERDRSVICVVEETFDAFAIEKTGKFKGVYHVIGGRLSPLEG
ITAEDLNIEKLVERVDKNGVKEIILATNPTVEGEATASYIHNLLKDRDVIISRIAYGLPF
GAVLENADDFTLSKALEHKTII
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatatagatatcataccgtcaactttaaaagaggctgtagagaagatatctgag
cttccaggttatggtgagaaatcggcaaaaaggtttgccgtaaaccttcttgatatgccc
cgtggtgaggctatccagataattaaaacactgtttgatatgcttgagaagatacatcca
tgttctgagtgcggcctttacacagaagaggagatctgcagtatatgctcatctgaggaa
agggacagatcagttatatgtgttgttgaggagacatttgatgcatttgctatagaaaaa
acagggaagtttaaaggggtctaccatgttataggcggcagattatcaccccttgaaggt
attacagctgaagatctgaatattgaaaagcttgttgaaagggtagacaaaaacggtgta
aaggagatcatccttgcaacaaacccaacagttgagggagaagcaacagcatcatatata
cacaatctgctaaaggacagggatgttatcatctcccgtatagcctatggtcttcctttt
ggtgctgtcttagaaaatgcagacgatttcacactttcaaaagccctggaacacaaaact
atcatctga

DBGET integrated database retrieval system