KEGG   Persephonella marina: PERMA_0573Help
Entry
PERMA_0573        CDS       T00870                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmx  Persephonella marina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PERMA_0573 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PERMA_0573 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PERMA_0573 (trpB)
Enzymes [BR:pmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PERMA_0573 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525181..526425
Genome map
AA seq 414 aa AA seqDB search
MEYRFPDERGYYGQFGGKFLPETLIPALEELEEQYERIKNDGDFQRELVYYLQEYAGRPT
ILYYAHRLTEAVGGAKIYLKREDLLHTGAHKINNTLGQVLLTKKLGKRRIIAETGAGQHG
VSTATAASLFGLECVVYMGEEDAERQALNVFRMRLLGAKVEIVKSGSRTLKDAVNEALRD
WVTNVRTTHYVIGSALGPHPFPVIVRDFQSVIGRETREQIMEIEGRLPDAVVACVGGGSN
AIGMFYPFIQDENVRLVGVEAAGYGIETGQHAASINGGSVGVLHGMKTYFLQDEWGQIEH
THSISAGLDYPGVGPEHAYLKEIGRAEYITATDEEALEGFMLLSRTEGIIPALESSHAVI
KAVEIAKEIGKEGIVVINLSGRGDKDVQQVKNILDTNPDLMNRLEENLKKKYRV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggagtatagatttcctgatgagagaggctactacggtcagtttggaggtaagttttta
cctgagacattgataccagctctagaggagcttgaggagcagtatgagagaattaaaaat
gatggtgatttccagagggagcttgtttactaccttcaggagtatgcgggaaggcctact
atactttactacgcccacagacttactgaggctgtaggtggggcaaagatatatctgaaa
agggaagatcttttacatacaggagcccacaagataaataacacacttggacaggtcctt
ttaaccaaaaagcttggaaagagaaggataatagccgagacaggagctggtcagcacggt
gtctccacagcaacagctgcatccctttttggtctggaatgtgtagtttatatgggtgaa
gaggatgcagagagacaggcattaaatgttttcagaatgagacttctcggtgcaaaggtt
gagattgtaaagtctggaagtagaacgctgaaagatgctgttaatgaggcattgagagac
tgggtaacaaatgttagaactacacattatgttataggttctgcccttggacctcatcca
tttcctgttattgttagagatttccagtctgttataggaagagaaaccagagagcagata
atggagattgaaggaagacttcctgatgctgtagttgcatgtgtcggtggtggaagtaac
gcaatagggatgttttatccgtttatacaggatgagaatgtaaggcttgttggtgttgag
gctgcaggttacggtatagagacaggtcagcatgctgcaagtataaatggaggatctgta
ggtgttctccacggtatgaagacatacttccttcaggatgagtggggacagatagagcat
acgcactcaatatcagctggacttgattaccctggcgttggaccagaacatgcatatctt
aaagagatcggaagggcagagtatataacagcaacagatgaggaagcccttgaaggtttt
atgttactttcaagaacggaaggtatcatacctgcccttgaaagctcacacgctgttata
aaggctgttgagatagcgaaggagataggtaaagagggaatagttgttataaacctttca
ggtagaggagacaaggatgttcagcaggttaaaaatattctggatacaaatccagacctg
atgaacagacttgaggaaaatcttaagaaaaaatacagagtatag

DBGET integrated database retrieval system