KEGG   Persephonella marina: PERMA_0597Help
Entry
PERMA_0597        CDS       T00870                                 

Gene name
acsA_1
Definition
(RefSeq) acetate--CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmx  Persephonella marina
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PERMA_0597 (acsA_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PERMA_0597 (acsA_1)
   00620 Pyruvate metabolism
    PERMA_0597 (acsA_1)
   00640 Propanoate metabolism
    PERMA_0597 (acsA_1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PERMA_0597 (acsA_1)
   00680 Methane metabolism
    PERMA_0597 (acsA_1)
Enzymes [BR:pmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PERMA_0597 (acsA_1)
Lipid biosynthesis proteins [BR:pmx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PERMA_0597 (acsA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
552648..554543
Genome map
AA seq 631 aa AA seqDB search
MSNYKDEVHLKVQEKIYPPEDIVKRAWIKDYDEVYKRSIEDREGFWAEVAEELHWFRKWD
KVLEWNFPYAKWFVGGKTNITYNALDRHIKNGKGDKIAYIYVDEDGNEEKVTYSELLEKV
NALANGLKRLGLKKGDRVSIYMPNSIEAVVSMLACARIGVIHSVVFAGFSEGALHMRIDD
AKASAVITATYTKRRGRKIPLLPTVEKAIKDLDYIKNVIVWDRDKEGVTDKDDKYVDLNR
LIEENKGECSPEEMDSEDPLFILYTSGTTGKPKGVLHTTGGYMVNTYYTAKIVFDLHEDD
IYWCTADIGWITGHSYIVYAPLTNGVTSVIMEGVPVYPHPGIWWEYVDKYRVNIFYTAPT
AIRMLMRFGDEIPAKYDLSSLRILGSVGEPINPEAWHWYYEHIGRKRCVIVDTWWQTETG
SHMITTIPSYPMKPGKAGKPFFTIEAAVVDKNGNELPPNTVGYLVIKNPWPSMLRTCWGN
PERYEKYWKEIDNVYNADDLASIDEDGYIMIVGRADDVLSVAGHRIGTMEVESAIVEHPD
VVEAAVIGKPDPIKGQKIKAFVVLKVGVEPSDQLKKEIQNTVREILGPIAIPEEIDFVDK
LPKTRSGKIMRRVLRAQELGLEVGDLSTLED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactataaggatgaggtccatttaaaggttcaggagaagatatacccacctgag
gatatagttaagagagcgtggataaaggattatgacgaggtctataaaagatctattgag
gatagggaaggtttctgggctgaggttgcagaggagttacactggttcagaaaatgggat
aaggttcttgagtggaacttcccgtacgcaaaatggtttgttggaggaaagaccaacata
acttacaacgcacttgacagacatattaaaaatggtaaaggggacaagatagcttacata
tacgttgatgaggacggaaatgaggagaaggtaacatacagtgagcttttagaaaaggtt
aatgcccttgcaaacggtcttaaaagactcggtttaaaaaagggagatagggtttccata
tatatgccaaactctatagaggctgttgtatctatgcttgcatgtgcaaggataggtgtt
atacacagcgttgtttttgcaggtttcagtgaaggtgctctgcatatgaggattgatgat
gcaaaagcatctgctgttataacagcaacatacacaaaaagaaggggaagaaagataccc
ttacttcccacagttgagaaagctataaaggatcttgattatataaagaatgttattgta
tgggacagagataaagaaggtgttacagataaagatgataaatatgtagatcttaataga
ttgatagaggaaaataaaggagaatgttcacctgaggagatggactctgaagaccctctc
ttcatcctttacacatcaggaactacaggaaagccaaaaggtgttttacacacaaccggt
ggatatatggtaaacacttactacactgcaaagatagtttttgatctgcatgaggacgat
atatactggtgtacagctgatataggatggataacaggacacagttatatagtttacgca
cctttaacaaacggtgttacatctgtgatcatggaaggtgttcccgtttatccacatccc
ggtatatggtgggagtatgttgataaatacagggttaatatattttacacagcacctaca
gctattagaatgcttatgagattcggtgatgagatacctgcaaaatacgatctttcctct
ttaagaattcttggatctgttggtgagcctataaatcctgaggcatggcactggtattac
gagcatataggaaggaagagatgtgttattgttgatacatggtggcagacagagacaggt
tcacatatgataacgactataccttcctatcctatgaaaccgggaaaagctggaaaacca
ttcttcacgatagaggctgctgttgttgacaaaaatggaaatgaacttccaccaaacaca
gtcggttaccttgttataaaaaatccttggccttcaatgctcagaacatgctggggaaat
cctgagagatatgagaaatactggaaggagatagataacgtatacaatgcagacgacctt
gcatcaattgatgaagatggatacataatgatcgttggaagggctgatgatgttctctct
gtagctggacacaggataggaacgatggaggtcgaaagtgctatagttgagcatcctgat
gttgttgaggctgctgttataggtaagcctgatcctattaaaggccagaagataaaagca
tttgtagttttaaaggtaggtgttgaaccttctgatcagcttaagaaggagatccagaat
actgtgagggaaatacttggacctatagctatacctgaggagatagattttgttgataaa
cttccaaaaacgagatcaggaaagattatgagaagggttttaagggcacaggaactaggt
ttagaggttggcgatctctctacactggaagattag

DBGET integrated database retrieval system