KEGG   Persephonella marina: PERMA_0597Help
Entry
PERMA_0597        CDS       T00870                                 

Gene name
acsA_1
Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmx  Persephonella marina
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pmx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmx00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pmx00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:pmx00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:pmx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
552648..554543
Genome map
AA seq 631 aa AA seqDB search
MSNYKDEVHLKVQEKIYPPEDIVKRAWIKDYDEVYKRSIEDREGFWAEVAEELHWFRKWD
KVLEWNFPYAKWFVGGKTNITYNALDRHIKNGKGDKIAYIYVDEDGNEEKVTYSELLEKV
NALANGLKRLGLKKGDRVSIYMPNSIEAVVSMLACARIGVIHSVVFAGFSEGALHMRIDD
AKASAVITATYTKRRGRKIPLLPTVEKAIKDLDYIKNVIVWDRDKEGVTDKDDKYVDLNR
LIEENKGECSPEEMDSEDPLFILYTSGTTGKPKGVLHTTGGYMVNTYYTAKIVFDLHEDD
IYWCTADIGWITGHSYIVYAPLTNGVTSVIMEGVPVYPHPGIWWEYVDKYRVNIFYTAPT
AIRMLMRFGDEIPAKYDLSSLRILGSVGEPINPEAWHWYYEHIGRKRCVIVDTWWQTETG
SHMITTIPSYPMKPGKAGKPFFTIEAAVVDKNGNELPPNTVGYLVIKNPWPSMLRTCWGN
PERYEKYWKEIDNVYNADDLASIDEDGYIMIVGRADDVLSVAGHRIGTMEVESAIVEHPD
VVEAAVIGKPDPIKGQKIKAFVVLKVGVEPSDQLKKEIQNTVREILGPIAIPEEIDFVDK
LPKTRSGKIMRRVLRAQELGLEVGDLSTLED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactataaggatgaggtccatttaaaggttcaggagaagatatacccacctgag
gatatagttaagagagcgtggataaaggattatgacgaggtctataaaagatctattgag
gatagggaaggtttctgggctgaggttgcagaggagttacactggttcagaaaatgggat
aaggttcttgagtggaacttcccgtacgcaaaatggtttgttggaggaaagaccaacata
acttacaacgcacttgacagacatattaaaaatggtaaaggggacaagatagcttacata
tacgttgatgaggacggaaatgaggagaaggtaacatacagtgagcttttagaaaaggtt
aatgcccttgcaaacggtcttaaaagactcggtttaaaaaagggagatagggtttccata
tatatgccaaactctatagaggctgttgtatctatgcttgcatgtgcaaggataggtgtt
atacacagcgttgtttttgcaggtttcagtgaaggtgctctgcatatgaggattgatgat
gcaaaagcatctgctgttataacagcaacatacacaaaaagaaggggaagaaagataccc
ttacttcccacagttgagaaagctataaaggatcttgattatataaagaatgttattgta
tgggacagagataaagaaggtgttacagataaagatgataaatatgtagatcttaataga
ttgatagaggaaaataaaggagaatgttcacctgaggagatggactctgaagaccctctc
ttcatcctttacacatcaggaactacaggaaagccaaaaggtgttttacacacaaccggt
ggatatatggtaaacacttactacactgcaaagatagtttttgatctgcatgaggacgat
atatactggtgtacagctgatataggatggataacaggacacagttatatagtttacgca
cctttaacaaacggtgttacatctgtgatcatggaaggtgttcccgtttatccacatccc
ggtatatggtgggagtatgttgataaatacagggttaatatattttacacagcacctaca
gctattagaatgcttatgagattcggtgatgagatacctgcaaaatacgatctttcctct
ttaagaattcttggatctgttggtgagcctataaatcctgaggcatggcactggtattac
gagcatataggaaggaagagatgtgttattgttgatacatggtggcagacagagacaggt
tcacatatgataacgactataccttcctatcctatgaaaccgggaaaagctggaaaacca
ttcttcacgatagaggctgctgttgttgacaaaaatggaaatgaacttccaccaaacaca
gtcggttaccttgttataaaaaatccttggccttcaatgctcagaacatgctggggaaat
cctgagagatatgagaaatactggaaggagatagataacgtatacaatgcagacgacctt
gcatcaattgatgaagatggatacataatgatcgttggaagggctgatgatgttctctct
gtagctggacacaggataggaacgatggaggtcgaaagtgctatagttgagcatcctgat
gttgttgaggctgctgttataggtaagcctgatcctattaaaggccagaagataaaagca
tttgtagttttaaaggtaggtgttgaaccttctgatcagcttaagaaggagatccagaat
actgtgagggaaatacttggacctatagctatacctgaggagatagattttgttgataaa
cttccaaaaacgagatcaggaaagattatgagaagggttttaagggcacaggaactaggt
ttagaggttggcgatctctctacactggaagattag

DBGET integrated database retrieval system