KEGG   Persephonella marina: PERMA_0629Help
Entry
PERMA_0629        CDS       T00870                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pmx  Persephonella marina
Pathway
pmx00240  Pyrimidine metabolism
pmx00250  Alanine, aspartate and glutamate metabolism
pmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PERMA_0629 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PERMA_0629 (pyrB)
Enzymes [BR:pmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PERMA_0629 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACO03838
UniProt: C0QUQ3
Position
complement(584611..585519)
Genome map
AA seq 302 aa AA seqDB search
MKNLISVNNIELKDFEGIYKLFRDYKEKYKNGETKFTDLRGYSILLPFFESSTRTRTSFE
LAGKILGADTINISGSSSSVKKGETLYDTIKTLEAMNADFIVLRHYMSGAAHIVANKVKS
RVINAGDGTHEHPSQALLDAFTILEKKGKIEGLKIVIVGDILHSRVARSDIKLLKMLGAE
ITICGPQTMLPRHLEVFEVDYVTTDVNEALKGKDVAIFLRIQLERQKKVFFSTLNEYSIR
YGLNQERVNLLKEDAVIMHPGPVNRGIEMQSELVYGDRSLILDQVENGLFTRMAIYRYLL
QN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaacttaatatctgtaaataatattgaactgaaggattttgaaggtatatataaa
ctgttcagagattacaaggaaaaatataaaaacggggaaacaaagtttacagaccttaga
ggatactcaatactcctcccattttttgaaagctcaacaagaacaagaacatcatttgaa
cttgcaggcaagatattaggagccgatacgataaatatatcaggatcttcaagctctgta
aaaaaaggggaaacactttacgacacaataaaaacccttgaggctatgaatgcagacttt
atagttttaagacattatatgtcaggcgctgcacatatcgtagcaaacaaagtaaaatcc
agagttataaatgcaggggacggaacacatgagcatccttcacaggctcttttagatgcc
tttaccattcttgaaaagaaagggaagatagaaggactgaagattgtaatagttggggat
atacttcacagcagggtggcaagatcagacataaagcttttaaagatgttaggtgcagaa
ataacgatatgcggcccacagaccatgcttccgagacatcttgaggtttttgaggttgac
tacgtcacaacagatgttaatgaggcattgaaggggaaagatgtggctatattcctgagg
atacagcttgaaagacagaaaaaggtgttcttctcaacattaaacgagtactcaataagg
tatgggcttaatcaggaaagggttaaccttctcaaagaggatgccgtcataatgcatcca
ggtcctgtaaacagaggtattgagatgcagagtgaacttgtgtatggggatagaagtctt
atactggatcaggtggaaaacggtcttttcacaagaatggctatatacagatatctacta
cagaactaa

DBGET integrated database retrieval system