KEGG   Persephonella marina: PERMA_0647Help
Entry
PERMA_0647        CDS       T00870                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmx  Persephonella marina
Pathway
pmx00260  Glycine, serine and threonine metabolism
pmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmx01100  Metabolic pathways
pmx01110  Biosynthesis of secondary metabolites
pmx01130  Biosynthesis of antibiotics
pmx01230  Biosynthesis of amino acids
Module
pmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PERMA_0647
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PERMA_0647
Enzymes [BR:pmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PERMA_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Glyco_trans_4_3
Motif
Other DBs
NCBI-ProteinID: ACO04123
UniProt: C0QUS1
Position
complement(604710..606005)
Genome map
AA seq 431 aa AA seqDB search
MKKILLEDHEIPKQWYNILPDLPSPLEPPLDPQTNQPMSPEKLKALFPEALIEQEVSDKR
WIDIPPEVLDIYSIWRPTPLIRADRLEEFLDTPAKIYYKYEGVSPAGSHKPNTAVAQAYY
NAKEGVKRLTTETGAGQWGSSLAFAGQYFGIEIKVYMVKVSYHQKPYRRVLMETWGAKVI
PSPSPYTETGKRILEEDPDNPGSLGIAISEAVEEALSREDTHYSLGSVLNHVLLHQTVIG
LEAKKQLEKVGQYPDIVIGSAGGGSNFAGLSLPFVMDKLEGSKNPRFIAVEPSSCPTLTK
GRYEYDFGDTAGMTPLMKMHTLGHDFIPPSIHAGGLRYHGMAPIISKLYEEKIIEAVAVP
QTAIFKAAVDFARTEGIIPAPESAHAVRAAIDEALRCRETGEEKVILFNLSGHGLLDLSA
YQQYLEGKLTD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcttacttgaagatcatgagataccaaaacagtggtacaacattctgcca
gatttaccctcacctcttgaaccacctcttgatccacagacaaatcagcctatgagtcct
gagaagcttaaagctttattccctgaagcccttattgaacaggaggtttcagataaaaga
tggatagatataccacctgaggttcttgatatttactctatatggagaccaacaccactg
ataagggcagacaggcttgaggagtttttagatacacctgcgaaaatatactacaagtat
gaaggagtaagtcctgcaggaagtcataaacccaatacagctgttgcacaggcttactat
aatgcaaaggaaggggtaaaaaggttaacaacagagacaggtgcagggcagtgggggagt
tctcttgcgtttgcaggacagtattttggtatagagataaaggtatatatggttaaggtg
agctatcaccagaagccatacagaagagtacttatggagacatggggagcaaaggtgata
ccaagtcccagcccttacactgaaacaggtaagaggatacttgaggaagatcctgataat
cctggaagtctcggtattgcaataagtgaagctgttgaggaagcgttaagcagagaagat
acacattactctcttggaagtgttctaaaccacgttttacttcaccagacggttatagga
cttgaagctaaaaaacaacttgaaaaagtaggtcagtatcctgatatagttataggatct
gcaggaggtggaagtaattttgcaggtctatccctcccatttgttatggataaacttgaa
ggctctaaaaatcccagatttatagctgttgagccttcatcatgtccgacattaacaaaa
ggcagatatgagtatgattttggagatacagcaggtatgaccccccttatgaagatgcac
acacttggacatgattttattccaccatcaatacatgcaggtggactgagatatcacggg
atggcacctattatctcaaaactgtacgaagagaaaattatagaggctgtcgctgttcca
cagacagcaatattcaaagcggctgttgatttcgcaagaactgaaggtattattccagct
cctgaatctgcacatgctgtcagggcagctattgacgaagctttaagatgcagggaaaca
ggtgaggaaaaagtaatactcttcaatctaagtgggcatggacttttagatctttcagca
taccagcagtatctggagggcaagctgacagattaa

DBGET integrated database retrieval system