KEGG   Persephonella marina: PERMA_0744Help
Entry
PERMA_0744        CDS       T00870                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pmx  Persephonella marina
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PERMA_0744
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PERMA_0744
Enzymes [BR:pmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PERMA_0744
Two-component system [BR:pmx02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PERMA_0744
Bacterial motility proteins [BR:pmx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PERMA_0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(698214..699245)
Genome map
AA seq 343 aa AA seqDB search
MINTVIVDDSSTVRAALKKILGDAKDINISGIATNGLEAVELVEKLRPDVVTLDIEMPVM
NGLEALEKIKKVSPSTKIIILSSLTEEGAEITFEALKKGADDFITKPSSFMDLFKLKEDL
INKIRSLSQSKVKPSFHRQKTEINPEFDDTPLIGIGASTGGPQVVSEILSGIKENLKAHV
VVAIHMPEGFTQTFAKRLNQSSRITVKEAENGEILKDSVAYIVKGGKNMIIENFNGKRMF
KTINKKSRFVPSIDLLLSSIAHTTKKNSVGIILSGMGNDGSEGVKEIKKYGGLNIAQNPE
SCVLPSMPENAIKTGKVDLILDPEQITEFLNNIQEVRYERKSI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaatacagttatagttgatgactcctcaacagtaagagcagctttaaaaaagata
cttggtgatgcaaaagatataaatatctcaggaatcgccacaaacggtcttgaagctgtt
gaacttgttgaaaaactaaggcccgatgtggtcacacttgatattgagatgcccgttatg
aatggacttgaggcccttgagaagataaaaaaggtctcaccttcaacaaagataatcata
ctgagctccttaacagaggaaggtgcagaaatcacatttgaagctttaaaaaaaggggct
gacgattttataacaaaaccttcatcattcatggatctttttaaacttaaagaagatctt
ataaataagatcagatctctatcacaatcaaaggtaaagccatcattccacagacagaaa
actgagataaatccagaatttgatgatactcctcttatcggaatcggggcttcaacaggt
ggtcctcaggtcgtgtctgaaatactttctggtatcaaagaaaatcttaaagctcatgtt
gtcgtagctatccatatgcctgaagggtttacccagacttttgcaaaaagattaaaccag
agctccagaataacggttaaagaagcagaaaatggagagatactaaaagacagtgttgcg
tatatagtaaaaggcggaaaaaatatgatcattgaaaatttcaacggaaagagaatgttt
aaaacgattaataaaaaaagcagatttgtaccatccatagacctactcttaagctccata
gcacatactacgaaaaaaaatagtgtggggattatcctatcaggtatgggaaatgacggt
agtgaaggtgtaaaagaaataaaaaaatacggtgggttaaatatagcccagaatccggaa
agctgcgttcttccatcaatgcccgaaaacgctataaaaacaggtaaggtcgatcttatt
ctagatccggaacagattaccgaatttctaaataatattcaggaggtaagatatgaacga
aaatctatttga

DBGET integrated database retrieval system