KEGG   Persephonella marina: PERMA_0744Help
Entry
PERMA_0744        CDS       T00870                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pmx  Persephonella marina
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pmx02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pmx02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(698214..699245)
Genome map
AA seq 343 aa AA seqDB search
MINTVIVDDSSTVRAALKKILGDAKDINISGIATNGLEAVELVEKLRPDVVTLDIEMPVM
NGLEALEKIKKVSPSTKIIILSSLTEEGAEITFEALKKGADDFITKPSSFMDLFKLKEDL
INKIRSLSQSKVKPSFHRQKTEINPEFDDTPLIGIGASTGGPQVVSEILSGIKENLKAHV
VVAIHMPEGFTQTFAKRLNQSSRITVKEAENGEILKDSVAYIVKGGKNMIIENFNGKRMF
KTINKKSRFVPSIDLLLSSIAHTTKKNSVGIILSGMGNDGSEGVKEIKKYGGLNIAQNPE
SCVLPSMPENAIKTGKVDLILDPEQITEFLNNIQEVRYERKSI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaatacagttatagttgatgactcctcaacagtaagagcagctttaaaaaagata
cttggtgatgcaaaagatataaatatctcaggaatcgccacaaacggtcttgaagctgtt
gaacttgttgaaaaactaaggcccgatgtggtcacacttgatattgagatgcccgttatg
aatggacttgaggcccttgagaagataaaaaaggtctcaccttcaacaaagataatcata
ctgagctccttaacagaggaaggtgcagaaatcacatttgaagctttaaaaaaaggggct
gacgattttataacaaaaccttcatcattcatggatctttttaaacttaaagaagatctt
ataaataagatcagatctctatcacaatcaaaggtaaagccatcattccacagacagaaa
actgagataaatccagaatttgatgatactcctcttatcggaatcggggcttcaacaggt
ggtcctcaggtcgtgtctgaaatactttctggtatcaaagaaaatcttaaagctcatgtt
gtcgtagctatccatatgcctgaagggtttacccagacttttgcaaaaagattaaaccag
agctccagaataacggttaaagaagcagaaaatggagagatactaaaagacagtgttgcg
tatatagtaaaaggcggaaaaaatatgatcattgaaaatttcaacggaaagagaatgttt
aaaacgattaataaaaaaagcagatttgtaccatccatagacctactcttaagctccata
gcacatactacgaaaaaaaatagtgtggggattatcctatcaggtatgggaaatgacggt
agtgaaggtgtaaaagaaataaaaaaatacggtgggttaaatatagcccagaatccggaa
agctgcgttcttccatcaatgcccgaaaacgctataaaaacaggtaaggtcgatcttatt
ctagatccggaacagattaccgaatttctaaataatattcaggaggtaagatatgaacga
aaatctatttga

DBGET integrated database retrieval system