KEGG   Persephonella marina: PERMA_0896Help
Entry
PERMA_0896        CDS       T00870                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pmx  Persephonella marina
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PERMA_0896
Enzymes [BR:pmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PERMA_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(853110..853676)
Genome map
AA seq 188 aa AA seqDB search
MNGEIIKEIIFTGEVLYREGLVNSHAGNISVREGDHLYITKTGSMLGYLKEDDIVKLPIF
YETVKDRIASSELIVHREIYKNTEAKAVIHAHPVHAVVISFLTENIFVPVDNEGKLFVGE
VPILDVEKPSGSKELAEKLSETFKNQNKKIVIVKKHGSFVIGNNLNQALKLTSDLEFCSK
VFYLLKKR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaatggagagatcattaaagagataatatttacaggggaagttctttacagggaggga
ctggtaaacagtcatgcagggaatatatcagtcagagaaggtgaccacctttatataaca
aagacagggagtatgcttggctaccttaaagaagatgatatagtaaaacttcctatattt
tacgaaactgtaaaggacaggatagcatcaagcgagcttatagttcacagggagatatac
aaaaatacagaggctaaagctgtaatccatgcacatcctgttcatgcagttgtgataagt
tttttaacagaaaatatttttgtacctgtagacaatgaaggaaagctttttgtaggggag
gtccctattctcgacgttgaaaaaccaagtggttctaaagaacttgctgaaaaactttca
gaaaccttcaaaaatcagaataaaaaaatcgtgatagttaagaaacatgggagttttgtt
ataggaaataatcttaatcaggctctaaaactcacatctgaccttgagttctgcagtaaa
gtattttatctcctgaaaaaaagatag

DBGET integrated database retrieval system