KEGG   Persephonella marina: PERMA_0904Help
Entry
PERMA_0904        CDS       T00870                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmx  Persephonella marina
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PERMA_0904 (folE)
Enzymes [BR:pmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PERMA_0904 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(863859..864416)
Genome map
AA seq 185 aa AA seqDB search
MSIDREKLKRSIRLFLEAIGEDPDREGLKETPDRIVRLWEEFKSYENFNMTVFEDIGDYN
EMVVVRDIQFYSFCEHHLLPFFGKAHIAYIPEKKVCGLSKLVRVVNKFAYRPQVQERLTA
QIAEFLEKELSPKGVAVVLEAEHLCMSMRGVKNPTSYTITSKLTGAFMEDEKTRNEFLNL
IHNGR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgagtattgacagggaaaaattaaaaagatctatcagactttttcttgaagctatcgga
gaggatccggacagggaaggtttaaaggaaacccctgacagaatagtgagactgtgggaa
gagtttaaatcctacgaaaactttaatatgacagtttttgaagatataggtgattataat
gagatggttgttgtgagagacatacagttctactcattctgcgaacaccatctccttcct
tttttcggaaaagcccacatagcttacatacctgaaaagaaggtgtgtggactttcaaag
ctcgtaagggttgttaacaagtttgcgtacagacctcaggttcaggaaagactgacggca
cagatagcagaatttcttgagaaagagttaagtccaaaaggtgttgctgtggttcttgag
gccgagcacctgtgtatgtcaatgagaggtgttaaaaacccaacttcatacaccataacg
agcaagctaacaggtgcgtttatggaagatgaaaaaacaagaaacgagttcctaaatctc
atacataacggaagatag

DBGET integrated database retrieval system