KEGG   Persephonella marina: PERMA_0915Help
Entry
PERMA_0915        CDS       T00870                                 

Gene name
hybA
Definition
hydrogenase-2, small subunit (EC:1.12.99.6)
Orthology
K06282  
hydrogenase small subunit [EC:1.12.99.6]
Organism
pmx  Persephonella marina
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PERMA_0915 (hybA)
Enzymes [BR:pmx01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With other acceptors
    1.12.99.6  hydrogenase (acceptor)
     PERMA_0915 (hybA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(874340..875260)
Genome map
AA seq 306 aa AA seqDB search
MKNLLWIQGLTCSGNSQSFLCGENPTVSDFFSEINLLWHPEISYSEDIMDILNGIYRDEI
KLDFLIIEGAVTSNKRFHRIGKYSIKYIINKLKSKADYIIAVGNCAVHGNYPALYNPDQI
TGIQFGLNGKKGLLPQKFRTKSGYPVINITGCPVHPEWITKTVLTLSYGLDLKLDSQNRP
KELYMYLSHDGCTRNEYFEWKVEAEEFGTKEGCLFYELGCRGPVTHAPCNRILWNGRSSK
TRAGMPCIGCTEFDFPYRENYLETKKYMGIPQDIPLGVTKRAYIMITGVAKTFKNERLTK
KLEETD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctcctatggatacagggtttaacatgtagtggaaactcccagtcttttctg
tgcggtgaaaatccaacggtctcagactttttcagtgagataaatcttttatggcatcct
gagataagctattctgaagatataatggatatactcaacggtatatacagggatgagata
aagcttgattttttaattattgaaggtgctgtaacaagtaacaaaagatttcacagaata
ggaaagtactcaataaagtacataataaataaacttaaaagtaaagccgattatatcatc
gctgttggaaactgtgcagttcacggtaactatccggctttatacaatcctgaccagata
actggcatccagtttggactgaacggtaaaaaaggtctcttaccacagaaattcagaact
aaatcaggttatcctgtgataaatataacaggatgtcctgtccatccagaatggataaca
aagactgttctgacattatcatacggacttgatcttaaacttgacagtcagaacagacca
aaggagctgtacatgtacctttcccacgatggatgtacaagaaatgagtattttgagtgg
aaggttgaggctgaagagtttggaacaaaagagggctgtctattctatgagcttggctgt
agaggtcctgtaactcatgccccatgtaacaggatactctggaatggaagatcatcaaaa
acaagggcgggtatgccctgtattggatgtacagagtttgatttcccttacagggaaaac
taccttgaaacgaaaaagtatatgggtattccacaggatataccccttggagtaacaaaa
agagcgtacataatgataacaggtgttgcaaaaacatttaaaaatgagagactgacaaaa
aaacttgaagagacagattag

  All links  
No link information was found.   
DBGET integrated database retrieval system