KEGG   Persephonella marina: PERMA_0915Help
Entry
PERMA_0915        CDS       T00870                                 

Gene name
hybA
Definition
hydrogenase-2, small subunit (EC:1.12.99.6)
Orthology
K06282  
hydrogenase small subunit [EC:1.12.99.6]
Organism
pmx  Persephonella marina
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:pmx00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(874340..875260)
Genome map
AA seq 306 aa AA seqDB search
MKNLLWIQGLTCSGNSQSFLCGENPTVSDFFSEINLLWHPEISYSEDIMDILNGIYRDEI
KLDFLIIEGAVTSNKRFHRIGKYSIKYIINKLKSKADYIIAVGNCAVHGNYPALYNPDQI
TGIQFGLNGKKGLLPQKFRTKSGYPVINITGCPVHPEWITKTVLTLSYGLDLKLDSQNRP
KELYMYLSHDGCTRNEYFEWKVEAEEFGTKEGCLFYELGCRGPVTHAPCNRILWNGRSSK
TRAGMPCIGCTEFDFPYRENYLETKKYMGIPQDIPLGVTKRAYIMITGVAKTFKNERLTK
KLEETD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctcctatggatacagggtttaacatgtagtggaaactcccagtcttttctg
tgcggtgaaaatccaacggtctcagactttttcagtgagataaatcttttatggcatcct
gagataagctattctgaagatataatggatatactcaacggtatatacagggatgagata
aagcttgattttttaattattgaaggtgctgtaacaagtaacaaaagatttcacagaata
ggaaagtactcaataaagtacataataaataaacttaaaagtaaagccgattatatcatc
gctgttggaaactgtgcagttcacggtaactatccggctttatacaatcctgaccagata
actggcatccagtttggactgaacggtaaaaaaggtctcttaccacagaaattcagaact
aaatcaggttatcctgtgataaatataacaggatgtcctgtccatccagaatggataaca
aagactgttctgacattatcatacggacttgatcttaaacttgacagtcagaacagacca
aaggagctgtacatgtacctttcccacgatggatgtacaagaaatgagtattttgagtgg
aaggttgaggctgaagagtttggaacaaaagagggctgtctattctatgagcttggctgt
agaggtcctgtaactcatgccccatgtaacaggatactctggaatggaagatcatcaaaa
acaagggcgggtatgccctgtattggatgtacagagtttgatttcccttacagggaaaac
taccttgaaacgaaaaagtatatgggtattccacaggatataccccttggagtaacaaaa
agagcgtacataatgataacaggtgttgcaaaaacatttaaaaatgagagactgacaaaa
aaacttgaagagacagattag

DBGET integrated database retrieval system