KEGG   Persephonella marina: PERMA_0932Help
Entry
PERMA_0932        CDS       T00870                                 

Definition
signal transduction response regulator
Orthology
K13590  
diguanylate cyclase
Organism
pmx  Persephonella marina
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(889878..890873)
Genome map
AA seq 331 aa AA seqDB search
MNIVRKELSFLIKHNIPPVPNNYEKWFYIFCSLVEENKDLSDLEIIGLYKEIYEEDYQIV
DINGSKEKEAEKVSGKLRDIADKIDITLKELIQNIDNYQANIDSHASSLAEKTSEMQISD
ISATVHLILDELKELKSQNEFLKNQIKKYHSEIHQLRQELSHAKTEASMDFLTGLVNRRR
FERALEDAIKDFEKRNYPFSLIYVDVDNFKDINDNYGHSVGDIVLKEIATIFKFYLRANT
IIGRIGGEEFAILLPGVEIEDAVKIAERLRNIIQNREIRIGPDRDEILRVTASFGVTQVK
KGDTVNSILHRADTAMYRAKKTGKNKVEVEL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgttcgtaaagagctgagttttcttatcaagcacaatattccacctgttcct
aataactatgaaaaatggttttatattttttgttctcttgttgaagaaaataaagatctt
tccgatcttgagataataggactttacaaagagatatatgaagaggactaccagattgtt
gatattaatggtagcaaggagaaagaagccgaaaaggtatcaggaaaacttagagatata
gccgacaagatagatataaccctgaaagagctaatacaaaatattgataactatcaggca
aatatagacagtcatgccagctcacttgctgagaagacaagcgagatgcagatatctgat
ataagtgccacagtccatttaatacttgatgaacttaaagaacttaaatctcagaatgag
tttctaaaaaatcagattaagaaataccattcggagattcaccagctcaggcaggaactt
tctcacgctaaaacagaagcctctatggactttcttaccggacttgttaacagaaggaga
tttgaaagagcccttgaggatgccataaaggattttgaaaagagaaactatccgttctca
cttatatatgttgatgttgataactttaaggatatcaacgataactacggtcacagtgtt
ggtgatatagttttgaaagagatagcgactatatttaagttctatctcagggcaaatacg
atcattggaaggataggcggagaggagttcgccatacttcttccaggtgttgagatagag
gatgctgtaaagatagcagagagactgagaaatataatccagaacagagagataagaata
ggtccggacagggatgagatactaagagttacagcaagttttggagtaacacaggttaag
aaaggtgatactgttaactcaatactgcacagagccgataccgcaatgtacagagcaaag
aaaactggaaaaaataaggttgaggtggagctttaa

DBGET integrated database retrieval system