KEGG   Persephonella marina: PERMA_0932Help
Entry
PERMA_0932        CDS       T00870                                 

Definition
(RefSeq) signal transduction response regulator
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
pmx  Persephonella marina
Brite
Enzymes [BR:pmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PERMA_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(889878..890873)
Genome map
AA seq 331 aa AA seqDB search
MNIVRKELSFLIKHNIPPVPNNYEKWFYIFCSLVEENKDLSDLEIIGLYKEIYEEDYQIV
DINGSKEKEAEKVSGKLRDIADKIDITLKELIQNIDNYQANIDSHASSLAEKTSEMQISD
ISATVHLILDELKELKSQNEFLKNQIKKYHSEIHQLRQELSHAKTEASMDFLTGLVNRRR
FERALEDAIKDFEKRNYPFSLIYVDVDNFKDINDNYGHSVGDIVLKEIATIFKFYLRANT
IIGRIGGEEFAILLPGVEIEDAVKIAERLRNIIQNREIRIGPDRDEILRVTASFGVTQVK
KGDTVNSILHRADTAMYRAKKTGKNKVEVEL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgttcgtaaagagctgagttttcttatcaagcacaatattccacctgttcct
aataactatgaaaaatggttttatattttttgttctcttgttgaagaaaataaagatctt
tccgatcttgagataataggactttacaaagagatatatgaagaggactaccagattgtt
gatattaatggtagcaaggagaaagaagccgaaaaggtatcaggaaaacttagagatata
gccgacaagatagatataaccctgaaagagctaatacaaaatattgataactatcaggca
aatatagacagtcatgccagctcacttgctgagaagacaagcgagatgcagatatctgat
ataagtgccacagtccatttaatacttgatgaacttaaagaacttaaatctcagaatgag
tttctaaaaaatcagattaagaaataccattcggagattcaccagctcaggcaggaactt
tctcacgctaaaacagaagcctctatggactttcttaccggacttgttaacagaaggaga
tttgaaagagcccttgaggatgccataaaggattttgaaaagagaaactatccgttctca
cttatatatgttgatgttgataactttaaggatatcaacgataactacggtcacagtgtt
ggtgatatagttttgaaagagatagcgactatatttaagttctatctcagggcaaatacg
atcattggaaggataggcggagaggagttcgccatacttcttccaggtgttgagatagag
gatgctgtaaagatagcagagagactgagaaatataatccagaacagagagataagaata
ggtccggacagggatgagatactaagagttacagcaagttttggagtaacacaggttaag
aaaggtgatactgttaactcaatactgcacagagccgataccgcaatgtacagagcaaag
aaaactggaaaaaataaggttgaggtggagctttaa

DBGET integrated database retrieval system