KEGG   Persephonella marina: PERMA_1046Help
Entry
PERMA_1046        CDS       T00870                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmx  Persephonella marina
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PERMA_1046 (tpiA)
   01230 Biosynthesis of amino acids
    PERMA_1046 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PERMA_1046 (tpiA)
   00051 Fructose and mannose metabolism
    PERMA_1046 (tpiA)
   00562 Inositol phosphate metabolism
    PERMA_1046 (tpiA)
Enzymes [BR:pmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PERMA_1046 (tpiA)
Exosome [BR:pmx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PERMA_1046 (tpiA)
  Exosomal proteins of bladder cancer cells
   PERMA_1046 (tpiA)
  Exosomal proteins of melanoma cells
   PERMA_1046 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1007278..1008048)
Genome map
AA seq 256 aa AA seqDB search
MRYLVAANWKMNKTVGETLEYLDRFLPSVKDLLSVDIMIAPPFTALSSASIRLDAAKKEG
EYNVKLGAQNMYYVEKGAFTGEISPVMLNELDVEYVILGHSERRHIFGEKDDLINKKVIT
AVETGIRPILCVGETLEEREQGKTLSVVERQIRNGLAGVEKDMAFIDIAYEPVWAIGTGV
NATPEQAQEVHRFIRSLINEISKGNDSNTRILYGGSVNEKNARDLIKEPNVDGFLVGTAS
LDPERFYKIITEVLEV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagatatcttgtagcagcaaactggaagatgaacaaaacggttggagaaacacttgag
tatcttgacagatttttaccttctgtaaaggatcttttatctgttgatattatgatagca
cctccttttacagctttatcatcagcatcaataagacttgacgctgcaaagaaggaaggt
gagtataacgtaaagcttggtgcccagaatatgtactatgttgaaaagggagctttcaca
ggtgagatctcgcctgttatgttaaatgagcttgatgttgagtatgttatactcggtcat
tctgagagaagacatatatttggtgaaaaagatgatcttataaataagaaggttataaca
gctgttgagacgggtataaggcctatactatgtgtaggtgagacacttgaagagagggag
cagggaaaaacattatcggttgttgagagacagataagaaacggtcttgctggtgtagaa
aaggacatggcctttatagatattgcttatgaacctgtctgggctatagggacaggtgtt
aatgcaacacctgaacaggctcaggaagttcacagatttataagatcacttataaatgag
atctctaagggaaatgactcaaacacaagaatactttacggtggaagtgttaatgaaaag
aatgcaagggatctcataaaggaaccgaatgttgatggatttctcgttgggacagcaagt
cttgatcctgaaagattttataagataataacagaggttttagaggtataa

DBGET integrated database retrieval system