KEGG   Persephonella marina: PERMA_1102Help
Entry
PERMA_1102        CDS       T00870                                 

Definition
protein disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pmx  Persephonella marina
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1054509..1055405)
Genome map
AA seq 298 aa AA seqDB search
MNIKSIFSVFLLILFVSLPSFSDECKIKDVSPEKMESKLRSVLGNGKVISVSRAPVEDLY
EVVIEIRNKRIPVYVDCSMRYLISGEIIDLKERRSLTRERAMELAKAMEEKKAKELEKRL
GKKKVEKLKNVLGERIAGVNLVDISKIPKTTVTFGNSRAKYTIYVIDDPECPFCAKFHDE
MLKVLDKRNDVKFEIILFPLPFHKHAQTIAQRILCEKSLKKKREILEESFNAVKSKDQSK
LSRLGKKCEKGKKIIEKHFEFAQAYGIGGTPTLIFPEGVVISGYMKADKISQVLDALK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaaagtatcttttcagtctttcttttaattctttttgtatcactaccatct
ttctctgatgaatgtaagataaaagatgtttcacctgagaagatggagagtaagctgagg
agcgtgctgggaaatggaaaagttatctccgtttcaagggcacctgttgaggatctttac
gaggttgttattgagataagaaacaaaagaatacctgtttatgttgactgttctatgaga
taccttatctcgggagagattattgatctgaaggagagaaggagccttaccagagaaagg
gctatggaacttgcaaaggctatggaagagaaaaaagctaaagagttagagaaaagactt
ggaaagaaaaaggttgaaaaacttaaaaatgttcttggtgagagaattgcaggtgtaaac
cttgttgatatctcaaaaatacctaagacgacagtaacttttggtaacagcagagcaaaa
tacacaatttatgttattgatgatccagaatgtcctttctgtgcgaagttccacgatgag
atgctgaaggttctggacaagaggaacgatgtgaagtttgagataatactgttcccactg
cctttccacaaacacgcccagacgatagcccagagaatactgtgtgaaaaaagccttaag
aaaaagagggaaattcttgaagagagctttaatgctgtcaagagtaaggatcaatcaaaa
ctcagcagattgggtaaaaagtgtgagaaaggtaagaagatcatagaaaaacattttgag
tttgcccaggcctacggtataggaggaacaccaacattgatattccctgaaggtgttgtt
atctcaggttatatgaaagctgataagataagtcaggtacttgacgctttaaaataa

DBGET integrated database retrieval system