KEGG   Persephonella marina: PERMA_1133Help
Entry
PERMA_1133        CDS       T00870                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pmx  Persephonella marina
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PERMA_1133 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PERMA_1133 (sucC)
   00640 Propanoate metabolism
    PERMA_1133 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PERMA_1133 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PERMA_1133 (sucC)
Enzymes [BR:pmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PERMA_1133 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1086036..1087202
Genome map
AA seq 388 aa AA seqDB search
MKVHEHQAKEIFARYGLPVPKGYPAFTVEEAVEAAQQLGKFPVVVKAQIHAGGRGKAGGV
KLANNLDEVQKYAAELLGKTLVTFQTGPEGLPVSRIYIEEGTNIDKEFYVAITLDRSKSK
LIIMASSEGGMEIEEVAAKNPEAIITEVIDPFLGLRPYQAREIALKLGLPKNLLNKAAGL
FVKLYELYMKEDASMVEINPLVLTKEGNIVILDAKVDFDDNALFRHPDIMEMEDPTQESE
LEVKAKQYNLNYIKLDGNIACMVNGAGLAMATMDTIKLAGGEPANFLDVGGSANAEQIAN
AFKIILSDPNVKAIFINIFGGILRCDRLAEGIIQASKEVNPHVPIIVRMEGTNVELGKKM
LAESGLDLIPADTMWEGAKKAVELASKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacatgagcatcaggccaaagagatatttgcaagatacgggcttcctgttcca
aaaggatatcctgcattcacagtcgaggaagcagttgaagctgcccagcagctgggaaaa
ttccctgtcgttgttaaagcccagattcatgctggtggaagaggaaaagcaggcggtgta
aaactggcaaacaaccttgatgaggttcagaagtatgcagctgaacttcttggaaaaaca
cttgtcactttccagacaggacctgaaggacttccagttagcagaatctacatagaagaa
ggaacaaacattgataaagagttttacgtagcgatcacacttgatagaagtaaatcaaaa
ctgataataatggcatcctcagaaggtggaatggagatagaagaggttgcagcgaaaaac
ccagaggcgattatcacagaggttatagatcctttcttaggcctcagaccgtaccaggca
agagagatagcgttaaagcttggacttcctaaaaatctcttaaacaaagcagcaggtcta
tttgtaaaactctacgagctttacatgaaagaagatgcatctatggttgagataaaccct
ctcgttctcacaaaagagggaaatatcgtaatacttgacgcaaaagttgattttgatgac
aacgctcttttcagacatcctgatattatggagatggaagatcctactcaggaatctgaa
cttgaggttaaggcaaaacagtacaaccttaactacatcaagttagatggaaatatagca
tgtatggttaacggtgcaggacttgctatggctacaatggacacaataaagcttgcaggt
ggtgaaccggcaaacttccttgatgttggaggatcagccaatgctgaacagatagcaaac
gcattcaagataatcctttcagatcccaatgtaaaagctatattcattaatatatttggt
ggaattctcagatgtgacagacttgctgaaggtataatacaggcatcaaaagaggtaaac
cctcatgtaccaataatagttagaatggaaggaacaaacgttgagcttgggaagaaaatg
cttgcagaatcaggattagaccttattcccgcagacacaatgtgggaaggtgcaaaaaaa
gctgttgagcttgcaagcaaagcataa

DBGET integrated database retrieval system