KEGG   Persephonella marina: PERMA_1133Help
Entry
PERMA_1133        CDS       T00870                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain (SCS-alpha)(Vegetative protein 63) (VEG63) (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pmx  Persephonella marina
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PERMA_1133
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PERMA_1133
   00640 Propanoate metabolism
    PERMA_1133
   00660 C5-Branched dibasic acid metabolism
    PERMA_1133
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PERMA_1133
Enzymes [BR:pmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PERMA_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1086036..1087202
Genome map
AA seq 388 aa AA seqDB search
MKVHEHQAKEIFARYGLPVPKGYPAFTVEEAVEAAQQLGKFPVVVKAQIHAGGRGKAGGV
KLANNLDEVQKYAAELLGKTLVTFQTGPEGLPVSRIYIEEGTNIDKEFYVAITLDRSKSK
LIIMASSEGGMEIEEVAAKNPEAIITEVIDPFLGLRPYQAREIALKLGLPKNLLNKAAGL
FVKLYELYMKEDASMVEINPLVLTKEGNIVILDAKVDFDDNALFRHPDIMEMEDPTQESE
LEVKAKQYNLNYIKLDGNIACMVNGAGLAMATMDTIKLAGGEPANFLDVGGSANAEQIAN
AFKIILSDPNVKAIFINIFGGILRCDRLAEGIIQASKEVNPHVPIIVRMEGTNVELGKKM
LAESGLDLIPADTMWEGAKKAVELASKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacatgagcatcaggccaaagagatatttgcaagatacgggcttcctgttcca
aaaggatatcctgcattcacagtcgaggaagcagttgaagctgcccagcagctgggaaaa
ttccctgtcgttgttaaagcccagattcatgctggtggaagaggaaaagcaggcggtgta
aaactggcaaacaaccttgatgaggttcagaagtatgcagctgaacttcttggaaaaaca
cttgtcactttccagacaggacctgaaggacttccagttagcagaatctacatagaagaa
ggaacaaacattgataaagagttttacgtagcgatcacacttgatagaagtaaatcaaaa
ctgataataatggcatcctcagaaggtggaatggagatagaagaggttgcagcgaaaaac
ccagaggcgattatcacagaggttatagatcctttcttaggcctcagaccgtaccaggca
agagagatagcgttaaagcttggacttcctaaaaatctcttaaacaaagcagcaggtcta
tttgtaaaactctacgagctttacatgaaagaagatgcatctatggttgagataaaccct
ctcgttctcacaaaagagggaaatatcgtaatacttgacgcaaaagttgattttgatgac
aacgctcttttcagacatcctgatattatggagatggaagatcctactcaggaatctgaa
cttgaggttaaggcaaaacagtacaaccttaactacatcaagttagatggaaatatagca
tgtatggttaacggtgcaggacttgctatggctacaatggacacaataaagcttgcaggt
ggtgaaccggcaaacttccttgatgttggaggatcagccaatgctgaacagatagcaaac
gcattcaagataatcctttcagatcccaatgtaaaagctatattcattaatatatttggt
ggaattctcagatgtgacagacttgctgaaggtataatacaggcatcaaaagaggtaaac
cctcatgtaccaataatagttagaatggaaggaacaaacgttgagcttgggaagaaaatg
cttgcagaatcaggattagaccttattcccgcagacacaatgtgggaaggtgcaaaaaaa
gctgttgagcttgcaagcaaagcataa

DBGET integrated database retrieval system