KEGG   Persephonella marina: PERMA_1257Help
Entry
PERMA_1257        CDS       T00870                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
pmx  Persephonella marina
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PERMA_1257
Enzymes [BR:pmx01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     PERMA_1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1180529..1182478
Genome map
AA seq 649 aa AA seqDB search
MKRKWRLGVISACAIGFIASTAHAQSPAEKVYVPPGKHDEFYAFLSGGFSGQLSVYGLPS
GRLIKVIPVFSVNPENGYGYSEETKAMLMTSHGFIPWGDTHHPELSQTNGVPDGRWIFIN
ENNTPRVARIDLRTFETIEILEIPNSGGNHASAFVTPNTEYITAGTRFSVPIPQKDVPIA
SYAKNFKGTLTFIRADKPGKMDIAFQILVPGYDYDLAHCGKGPSYGWCFYTSYNTEQAHT
LLEINASQKDKDYIAAVNWKRAEQCIAEGKYHVMKTEYYHNYIPDPEGDRIAVSEVKKEV
KVIIPKECKGVLYFLPTPKSPHGVDVDPTGEYIIAGGKLSTVLPIHSFSKMIKAIKNKDF
VGEVDGIPILRYEAISYCEVPNPCLGPLHTEFDGKGYSYTSCFITSEVIKVDYKKCKVVD
RAPTYYAVGHLMIPGGDSAKPWGKYLLPMNKITKDRFIPTGPELFHVGQLYDISGGKMQL
LLDVAEIGEPHYAQAIPASLVAPNTIKIYELEKNDHPYVTKSEEEAKVVRKGNEVHVYMT
TIRSHFTPDNIEGVKVGDTVYFHVTNIEQDWDVPHGFAIFGAENAELLVMPGETKTLVWK
PKKPGVYPFYCTDFCSALHQEMQGYVRVSPKGANVTIKYGTGEEMKTAK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaatggaggctgggagtaatctcagcttgtgctataggctttatagcctca
actgcacatgcacagagcccagctgagaaggtttatgttccaccgggaaaacatgatgag
ttttatgcatttctttcagggggatttagcggtcagctgagtgtctacggtcttccttca
ggaagattaattaaagttatacctgtattttccgtgaaccctgagaatgggtatggttat
tcagaagaaactaaagccatgctaatgacaagccatggtttcattccatggggtgatact
caccacccagaactttcccagacaaatggggttccagatggtagatggatatttattaac
gaaaataacactccaagagttgcaagaattgatctgagaacatttgagactatagagatt
ctggagataccgaactctggtggtaaccacgcctcagcatttgttacaccaaatactgag
tatataactgccggtacaagattctctgttcctataccacagaaggacgttcctattgca
agttatgctaaaaactttaagggaacactaacatttataagagctgataaacctggaaag
atggacatagcattccagatacttgttccaggttacgactatgaccttgcacactgtgga
aaaggaccttcttacggatggtgtttctatacttcgtacaacacggaacaggctcataca
ttactggagataaatgcttcacagaaggataaagactatatagctgcagtaaactggaaa
agagctgaacagtgtatagctgaaggtaagtaccatgttatgaaaacagaatactatcac
aactacatacctgatcctgaaggggatagaatagccgtttctgaagttaaaaaagaggtt
aaggttataattcctaaagagtgtaagggtgttctttacttcctgccaacaccaaaatca
ccacacggtgttgatgttgatccaacaggtgaatacataattgccggtggtaagctgtct
acagttcttccaatacactcattctctaagatgataaaagctatcaaaaacaaagatttt
gtaggagaggttgacggaattcctatactcagatacgaagctataagttactgtgaagtt
ccaaacccgtgtcttggacctctgcatacagagtttgatggaaaaggatactcttataca
tcatgtttcataacatcagaggttataaaggttgattacaagaaatgtaaggttgttgac
agggcaccaacatattacgctgttggacaccttatgatacctggaggtgactctgctaaa
ccttggggtaaatatctgcttcctatgaacaagataacaaaagacagatttatacctaca
ggtccagaacttttccacgttggacagctttatgatatatctggtggaaagatgcagctt
cttcttgatgtagctgagataggtgaaccacactacgcacaggcgatacctgcaagcctt
gttgcacctaacacaattaagatctatgagcttgagaagaacgaccacccatacgtaaca
aaatctgaagaagaagccaaagttgttagaaaaggaaatgaggttcatgtttacatgaca
acaataagatcacacttcacacctgataatatagagggtgttaaagttggtgatacagtt
tacttccatgttacaaatattgaacaggactgggacgttccacatggattcgctattttt
ggtgcagaaaatgctgaacttcttgtaatgccaggtgagacaaaaacacttgtatggaag
cctaaaaagccaggtgtttatcctttctactgtacagacttctgttctgctctccaccag
gaaatgcagggatacgtaagggtatctcctaaaggagctaatgtgaccattaagtacgga
actggcgaagaaatgaaaactgctaaataa

DBGET integrated database retrieval system