KEGG   Persephonella marina: PERMA_1298Help
Entry
PERMA_1298        CDS       T00870                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmx  Persephonella marina
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PERMA_1298 (pfkA)
   01230 Biosynthesis of amino acids
    PERMA_1298 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PERMA_1298 (pfkA)
   00030 Pentose phosphate pathway
    PERMA_1298 (pfkA)
   00051 Fructose and mannose metabolism
    PERMA_1298 (pfkA)
   00052 Galactose metabolism
    PERMA_1298 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PERMA_1298 (pfkA)
Enzymes [BR:pmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PERMA_1298 (pfkA)
Protein phosphatases and associated proteins [BR:pmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PERMA_1298 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1216903..1217877
Genome map
AA seq 324 aa AA seqDB search
MKKIAVLTSGGDAPGLNACIRAVVRAGHYYNCEVIGVRRGFKGLIEKQFISLTPRDVGGI
IDKGGTFLLSAREDRFLEYKYRKIAANNIREEKIDGLFVIGGNGSFQGAYLLSKEFGIPI
IGIPKTIDNDTYGTEYTIGFDTAVNNAVDAIDKIRDTSESHERVFVIEVMGRKSGFLALA
AGISTGADVTLIPEYPFPMHVIVKSIVDALNRGKKFAIVVVAEGVASAKEIADILNEKLK
PFDFGGVRYSVLGYIQRGGSPTSYDRIMASRFGVFAVEEFMRGNRDFMVALENGKILSKP
LEVSFGRIKKPDLKDFELNNILTI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagctgttcttacaagtggtggagatgcaccaggtctgaacgcatgtata
agggctgtagtaagggcgggacattactacaactgtgaagttataggtgtgagaagaggg
tttaaaggtcttatagaaaagcagtttatctctctcacaccacgtgatgttggtggaatt
atagataaagggggaacttttctcctctcggcgagggaagacagatttttagagtataaa
tacaggaagatcgctgctaataacataagggaagagaagattgatggactctttgttata
ggtggtaatggatctttccagggagcataccttctttccaaggagtttgggattcccatt
ataggtattccaaaaacgatagataacgatacatacgggactgagtacactataggtttt
gatacagctgtgaacaatgctgttgacgccatagacaagataagggatacatctgaatca
cacgagagggtttttgttatagaagttatgggaagaaaaagtggatttttagcccttgct
gctggtatatcaacaggtgctgatgtgacactcatacctgagtatccatttccgatgcat
gttattgtaaaatcaatcgttgatgcacttaacagaggtaagaagtttgctattgttgtt
gtggctgaaggggttgcatcagctaaagagatagctgatatacttaatgaaaaacttaaa
ccttttgattttggtggtgtaagatactcagttttaggctacatacagagaggtggatct
cccacttcctatgacagaataatggcttccagatttggtgtttttgctgttgaggagttt
atgagaggaaacagagattttatggttgcacttgaaaatggaaagatactttcaaaacct
cttgaagtatcctttggaagaataaaaaagccggatcttaaggattttgagcttaacaac
atactgacaatctaa

DBGET integrated database retrieval system