KEGG   Persephonella marina: PERMA_1327Help
Entry
PERMA_1327        CDS       T00870                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmx  Persephonella marina
Pathway
pmx00260  Glycine, serine and threonine metabolism
pmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmx01100  Metabolic pathways
pmx01110  Biosynthesis of secondary metabolites
pmx01130  Biosynthesis of antibiotics
pmx01230  Biosynthesis of amino acids
Module
pmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PERMA_1327 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PERMA_1327 (trpA)
Enzymes [BR:pmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PERMA_1327 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA Pterin_bind PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACO03694
UniProt: C0QR00
Position
1247078..1247848
Genome map
AA seq 256 aa AA seqDB search
MSLIGEIFSRKKPLICYFMAGYPSLEKSYETAKALIQSGADILEVGVPFSDPVADGPTIQ
VAHEKAVKDGITPVNVFQLTEKLKKEFPDIPLILMTYYNPIYVMGEQDFCKLAKEKGADG
FIVPDLPPEEAENFKRIANSSGLETIFLLAPTSHERRIKLIGEMSDSFIYYVSLTGITGE
RDTLPWEELENKVRQIKKITGKKVAVGFGVSKKEHTQKLSQISDGVIVGSAVVKLQGKAD
IEGIKSLVKQLKEGME
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttaataggtgagatattcagcaggaaaaaacctcttatctgttactttatggca
ggttatccctcccttgaaaaaagttatgaaacagcaaaggctttaatacagtcaggggct
gatattcttgaggttggagttccattttctgatcctgtagcagatggtccaacaattcag
gtcgcccatgaaaaagctgtaaaagacgggataacacctgtaaatgtttttcagcttact
gaaaagctaaaaaaagagtttccagatattcctttgatattgatgacttactataaccct
atatacgttatgggagaacaggatttctgtaagcttgctaaagagaagggagcagatggt
ttcatagtgcctgatcttccacctgaagaagcggaaaattttaagagaatagcaaacagt
tctggtcttgagacgatctttttacttgccccaacgtcacacgagagaagaataaagctt
ataggtgagatgagcgacagttttatatactatgtttccctcacaggtattacaggtgag
agggatacacttccgtgggaggagcttgagaacaaggtcagacagataaaaaagatcaca
ggcaaaaaggttgctgtaggatttggcgtatcaaaaaaggagcatacacagaagctatca
cagatatctgatggtgtgatagttggaagtgctgttgtaaaacttcagggtaaggcagat
atagaagggattaaaagccttgtaaaacagctgaaagagggtatggaatga

DBGET integrated database retrieval system