KEGG   Persephonella marina: PERMA_1327Help
Entry
PERMA_1327        CDS       T00870                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmx  Persephonella marina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PERMA_1327 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PERMA_1327 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PERMA_1327 (trpA)
Enzymes [BR:pmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PERMA_1327 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1247078..1247848
Genome map
AA seq 256 aa AA seqDB search
MSLIGEIFSRKKPLICYFMAGYPSLEKSYETAKALIQSGADILEVGVPFSDPVADGPTIQ
VAHEKAVKDGITPVNVFQLTEKLKKEFPDIPLILMTYYNPIYVMGEQDFCKLAKEKGADG
FIVPDLPPEEAENFKRIANSSGLETIFLLAPTSHERRIKLIGEMSDSFIYYVSLTGITGE
RDTLPWEELENKVRQIKKITGKKVAVGFGVSKKEHTQKLSQISDGVIVGSAVVKLQGKAD
IEGIKSLVKQLKEGME
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttaataggtgagatattcagcaggaaaaaacctcttatctgttactttatggca
ggttatccctcccttgaaaaaagttatgaaacagcaaaggctttaatacagtcaggggct
gatattcttgaggttggagttccattttctgatcctgtagcagatggtccaacaattcag
gtcgcccatgaaaaagctgtaaaagacgggataacacctgtaaatgtttttcagcttact
gaaaagctaaaaaaagagtttccagatattcctttgatattgatgacttactataaccct
atatacgttatgggagaacaggatttctgtaagcttgctaaagagaagggagcagatggt
ttcatagtgcctgatcttccacctgaagaagcggaaaattttaagagaatagcaaacagt
tctggtcttgagacgatctttttacttgccccaacgtcacacgagagaagaataaagctt
ataggtgagatgagcgacagttttatatactatgtttccctcacaggtattacaggtgag
agggatacacttccgtgggaggagcttgagaacaaggtcagacagataaaaaagatcaca
ggcaaaaaggttgctgtaggatttggcgtatcaaaaaaggagcatacacagaagctatca
cagatatctgatggtgtgatagttggaagtgctgttgtaaaacttcagggtaaggcagat
atagaagggattaaaagccttgtaaaacagctgaaagagggtatggaatga

DBGET integrated database retrieval system