KEGG   Persephonella marina: PERMA_1429Help
Entry
PERMA_1429        CDS       T00870                                 

Definition
cytochrome c551 peroxidase (cytochrome cperoxidase) (CCP) (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pmx  Persephonella marina
Brite
Enzymes [BR:pmx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PERMA_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345861..1346895
Genome map
AA seq 344 aa AA seqDB search
MFKKVSLMFGAVAVVSSTVFASDTALLEKARELFKPLPAEIPAPKTNPTTPEKVELGKKL
YYDPRLSLSGVISCNTCHNLATFGVDNVETALGHRFLTGGRNSPTVLNAGFHIAQFWDGR
AKTLEDQAKGPILAHVEMAMPNPDFVVLKLKTIPGYVEEFKKVFKNDPDPLTYDNVAKAI
AAFERTLVTPSRFDQFLKGDTNALTEKEKEGLKLFIDKGCASCHNGVAVGGGMFAKFGVV
KPYPTADLGRFKVTKKEEDKFVFKVPSLRNITKTYPYFHDGAVWDIREAVRIMGETQLGI
KLTQEEIDKIVAFLDSLTGEIPESARTVPVLPPSSKDTPKPKAD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaagtatcattaatgtttggtgctgttgctgtggtttcgtcgacagtattt
gcatcagatacagcattacttgaaaaggcgagagagctttttaagccattaccagctgag
atacctgcccctaaaacaaaccccacaacacctgagaaggtagagcttggtaaaaaactt
tactacgatccaagactgtcgctcagcggagttataagctgtaacacatgtcacaacctt
gcaacatttggtgttgataatgttgaaacagctctcggacacagatttttaacaggtgga
agaaactctccaacagttcttaatgcaggttttcatatagcacagttctgggatggaaga
gccaaaacacttgaagaccaggcaaaaggtcctattcttgcccatgttgagatggcaatg
ccaaaccctgattttgttgttttaaaactaaaaacaatcccaggttatgttgaggagttc
aaaaaggtgtttaaaaacgatcctgatcctttaacatacgacaatgttgcaaaagctata
gctgcatttgagagaacacttgtaacaccatcaagatttgatcagttcctgaaaggagat
acaaacgcattaacagaaaaagagaaggaaggtcttaaacttttcatagacaaaggatgt
gcaagctgtcataacggtgtagctgtaggtggtggaatgtttgcaaagtttggtgttgta
aagccttatcctacagctgaccttggaagatttaaggtaacaaagaaagaggaagacaaa
tttgtatttaaagttccatccctcagaaatattaccaaaacatacccttacttccatgat
ggagctgtgtgggatataagggaagctgtaagaataatgggtgaaacacagcttggaata
aaactgacacaggaagaaatagataaaatagttgctttccttgatagccttacaggtgag
attcctgagtctgcaaggactgtccctgtactacctccctcaagcaaggacaccccaaag
cccaaagctgactga

DBGET integrated database retrieval system