KEGG   Persephonella marina: PERMA_1552Help
Entry
PERMA_1552        CDS       T00870                                 

Definition
xylose repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmx  Persephonella marina
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PERMA_1552
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PERMA_1552
   00052 Galactose metabolism
    PERMA_1552
   00500 Starch and sucrose metabolism
    PERMA_1552
   00520 Amino sugar and nucleotide sugar metabolism
    PERMA_1552
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PERMA_1552
   00524 Butirosin and neomycin biosynthesis
    PERMA_1552
Enzymes [BR:pmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PERMA_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1498144..1499037
Genome map
AA seq 297 aa AA seqDB search
MRRYLGIDIGGTFIKFVYKKGDDIEKGKVYIREIISKNRPDLIVDEIRKIVKKYRPDILG
VAVAGLIDKKTGVLTASPNIKPLENFPFKDELENSLKIPVYIENDASLAAYGEYLYGAGK
GSEILICLTLGTGLGGGAVINGKLLTGVSGSAMEIGHTTIEMDGLPCHCGRKGCLESYVS
SYGLERIYYLYTDQKISSSQIITLANEGDLTAMRSMERFSEYLSVGLMNIVHIFNPDRIV
LAGGITENYPAVVDMAVSNLKNIAFHLPFRDLTVKRAELKEFSGAYGALGYAENESR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatatcttgggattgatataggcggaacttttataaagttcgtatacaaaaaa
ggtgatgatatagagaaagggaaggtttacataagagagataatctcaaaaaacagacct
gatcttatagtagatgagataaggaagatagtaaaaaaatacagacctgatattttagga
gttgctgtagcaggtcttatagacaaaaagacaggagttttaacagcatcgcccaatata
aagcctttggagaacttcccatttaaagatgagcttgaaaactctttaaagatacctgtt
tatattgagaatgacgcatctctcgctgcatacggggagtatctttacggagcagggaag
gggtctgagatacttatatgccttacacttggaacgggtcttggtggaggagctgtcata
aatggaaaacttcttacgggtgtatcaggctcagctatggagataggtcatacaaccatt
gagatggacggtctcccatgccactgcgggagaaaaggatgtcttgagtcctatgtatcg
tcgtacgggcttgagaggatatactacctttacacagatcagaagataagctcatcgcag
ataataacacttgcaaacgaaggtgatcttacagctatgagatctatggaaagattttcc
gagtatctttcagtaggattgatgaatatcgttcatatatttaaccctgacaggattgtt
cttgctggaggtataacggagaactatcctgctgttgtagatatggctgtatcaaatctc
aaaaatatagcctttcaccttccgttcagggatcttactgttaaaagggcggaattaaaa
gagttcagcggtgcttatggggctcttgggtatgcggaaaatgaaagtaggtaa

DBGET integrated database retrieval system