KEGG   Persephonella marina: PERMA_1675Help
Entry
PERMA_1675        CDS       T00870                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmx  Persephonella marina
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1625923..1626993
Genome map
AA seq 356 aa AA seqDB search
MNYRTHIIIEEKKKYKLIFPDPFYDPVYVEDEDQFKEVIKQLKSEGKGEIAKELTEKWVN
IHKEHFKINYRGKFLNLGTKTAVMGILNLTPDSFSDGGIYYGDIEKAVERVAQMLEEGAD
IIDIGGESTRPGAVPVSVEEELERVIPVIKAVRKELGDNFLISVDTYKSKVAERALEEGA
DIVNDISGMSFDPDMAKVISRYDCPVVINHTKGRPDSMQENVYYNDVVLEVIDFLENQIE
YGMKHGIRKDRFIIDPGIGFGKYVEHNVEIIKRLKEFKVLGHPVLIGISRKSFIGSIIKN
LLGRDETPSPEERLSGSLGATAIAVLNGAHIVRTHDVKETVEFLTLIDTIRGYRVV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgaactaccgcactcacataatcattgaagagaaaaaaaagtacaaacttatatttcca
gaccccttttatgatcctgtttacgttgaggatgaagaccagttcaaggaggttataaaa
cagctaaaatctgaaggaaaaggcgaaattgctaaagagttgacagaaaaatgggtaaat
atacataaagagcatttcaagataaattacagaggtaagtttcttaatcttggaacaaaa
accgccgtgatggggatactgaatctaacccccgactcattttcagatggtggtatatac
tacggagatattgagaaggctgttgaaagggttgcacagatgcttgaggaaggggctgac
attatagatataggtggtgaatcaacaagaccgggagctgttcctgtttctgtagaagag
gagcttgagagggttattccagttataaaggctgtaaggaaggagcttggagataacttt
cttatatcagtagatacatacaaatcaaaggttgctgaaagagctcttgaagaaggagct
gatatagtgaacgatataagcgggatgagttttgatccagatatggctaaggttataagc
agatatgactgtcctgttgttataaatcacacaaagggaagacctgacagtatgcaggaa
aatgtttactacaatgatgttgttcttgaggttatagattttttagagaatcagatagag
tatggtatgaagcacggtatcaggaaagacaggtttatcattgatccaggtataggtttc
ggtaagtatgttgagcataatgttgagataataaaaaggctgaaagagttcaaagttctg
ggacaccctgtacttataggtatatcgaggaagtcttttataggtagtataataaagaat
cttcttggcagggatgaaacaccttctcctgaggaaaggttaagcggaagtctcggtgca
acggcaatagctgttttaaatggagcacacatagtaagaacacatgatgttaaagagaca
gttgagtttttaacattaatagacactatcagaggttacagggttgtttga

DBGET integrated database retrieval system