KEGG   Persephonella marina: PERMA_1715Help
Entry
PERMA_1715        CDS       T00870                                 

Definition
ATP-citrate synthase (ATP-citrate (pro-S-)-lyase)(Citrate cleavage enzyme) (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
pmx  Persephonella marina
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Class
Metabolism; Overview; Carbon metabolism [PATH:pmx01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pmx00020]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:pmx00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1661195..1662505)
Genome map
AA seq 436 aa AA seqDB search
MAQRGIREYDGKRILAQNWDEYFDGAFQYDFKSVLITPDTDLDKVPEEHPWVKEMPLVAK
PDMLFGKRGKLGLIFFKKEKPGDVTWEDVKEWIKQKMSEEIEINGVKGHLTHFLVEPFVP
HKPEEEYYVAITTGEDEDIIYMSAFGGIEVEENWDKVVEVKIPVTASDEEIKKLIEENVP
ADIKDREKYADFVFRLYKLFRDLHFTYLEINPLVMVDSKIYPLDFVGRVDDTAQFVAGRK
WGDLEFPAGFGRDLTPEEKYIKEMDEKSGASLKLTILNPEGRIWTLVAGGGASVVYADTV
ADLGYVKELANYGEYSGNPSRAETREYVKTVFDLMTRSKHPKGHKILIIGGAIANFTDVA
KTFDGIIDAMKEYADKLREIGVRIYVRRGGPNYEVGLKRIKEAAEELGLPIEVYGPETHM
TEIVRKAIKEAEEIAA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacgaggtattagggagtacgatggaaaaaggatcttagcccagaactgggat
gagtattttgacggtgcattccagtacgattttaaatccgtccttataacaccggataca
gatctggataaagttcctgaagaacatccatgggttaaagaaatgcccctcgtagcaaaa
cctgatatgctttttggtaaaaggggtaagttaggtcttatatttttcaaaaaggaaaaa
ccaggcgatgttacatgggaggatgttaaagagtggataaaacagaagatgtctgaagag
atcgagataaatggagtaaaaggacatctaacacacttccttgtagaacctttcgttcca
cacaaacctgaggaagagtactacgttgctataacaacaggtgaggatgaagatattatc
tatatgtcagcattcggtggaatagaagtagaagaaaactgggacaaggttgttgaggtt
aagatacctgttacagcatctgatgaggaaataaaaaaacttattgaagagaatgttcca
gcagatataaaagatagagagaagtatgcagatttcgttttcagactttacaagcttttc
agagatctacacttcacataccttgagatcaacccgcttgtgatggttgacagcaaaata
tacccccttgactttgttggaagggttgatgataccgcacagtttgttgcaggaagaaaa
tggggagatcttgagtttcccgcaggatttggaagggatcttacacctgaagagaagtat
atcaaagagatggacgagaaatctggtgcatctttaaaactcacaattctgaatccagaa
ggtagaatctggacacttgttgcaggtggtggtgcatctgttgtttatgctgacacagtt
gctgatcttggatatgttaaggaacttgcaaactacggtgagtactcaggtaacccatca
agggctgagacaagggagtatgttaaaacagtatttgatcttatgacaagatcaaaacac
ccaaaaggacacaagattctcataatcggtggtgctatagctaacttcacagacgtagct
aaaacatttgacggaattatagatgctatgaaagagtacgcggacaaactgagagagata
ggagtgagaatatacgttagaagaggtggtccaaactacgaggtaggtcttaagagaata
aaagaagctgcagaagagttaggtcttcctattgaggtttacggacctgaaactcatatg
actgagattgttagaaaagcaataaaagaagcagaagagatagctgcataa

DBGET integrated database retrieval system