KEGG   Persephonella marina: PERMA_1857Help
Entry
PERMA_1857        CDS       T00870                                 

Definition
methyltransferase, UbiE/COQ5 family
Orthology
K02169  
malonyl-CoA O-methyltransferase [EC:2.1.1.197]
Organism
pmx  Persephonella marina
Pathway
Biotin metabolism
Metabolic pathways
Module
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Class
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:pmx00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1780398..1781099
Genome map
AA seq 233 aa AA seqDB search
MKNLVRFSFSRFSESYDREALLQRDAAKILIDFAGELKGRGIDLGCGTGFLYRLSGWENI
TGIDISEDMIRFYRRFNPAGIVADMEDLPFRDKSFDYAVSNFSIHWADFEKTVKEIKRVL
KDNGKFVFNIPLSGSMSVVEEILGDTKFDFLPAEKVIELLDKNQFSVEQFFIKDLKKDFE
DGYSLLTHLHKTGVAINTGSKTLGEKRKIVKKFKEYTHPVILNFKLLFVKAKL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatcttgttagattttcattttcaaggttctcagaaagttacgacagggaagct
cttttacagagagatgctgcaaagatactcattgattttgcaggtgagcttaaaggtaga
ggtattgatttaggctgtggaacaggttttttatacagattatcaggatgggagaatatc
acaggtatagatatatcagaggatatgatcagattttacagaaggtttaatcctgcaggt
atagtagctgatatggaggatcttcctttcagggataaaagttttgattatgctgtttct
aacttttccatacactgggcagattttgaaaagacagttaaagagataaaaagggttctg
aaggataatggaaagtttgtattcaatatacctttatcaggaagtatgagtgttgtagag
gagatattaggggatacaaagtttgattttctaccagctgaaaaagtgattgaactgtta
gacaaaaatcagtttagtgtggaacagttttttattaaggatctgaaaaaagattttgag
gatggatacagccttcttacacaccttcacaaaacaggtgttgcgataaacacaggcagt
aaaacacttggtgagaaaagaaagatagttaaaaaattcaaagaatacacccatccagta
atactgaactttaagcttctgttcgtgaaagctaagttgtaa

DBGET integrated database retrieval system