KEGG   Persephonella marina: PERMA_A0039Help
Entry
PERMA_A0039       CDS       T00870                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pmx  Persephonella marina
Brite
Enzymes [BR:pmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PERMA_A0039
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:complement(31458..32126)
Genome map
AA seq 222 aa AA seqDB search
MKNSILGLLACFSFSFAGVLEQTGAKIVEEKDLGDISQIVIQFPDGRKEVGYITKDNKYL
IIGNVIDAKTGENITAKKYRELDKVDVSKVPLDEAVKLKFGKGTKKLIMVADPDCPFCKK
AYQYLKNKDVEVYLFLFPLNIHPQAYDKSVKILCSKDPAKAYDKVESGNQLQVSKCKEGE
DKLKRHILIANKLGVRGTPLFIDMQGHKINGLNIPELEEALK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatagtattttaggcttgcttgcttgttttagtttttcttttgcaggggttctg
gagcagacaggggcaaagattgtagaggaaaaggatttaggggatatatctcaaatagtt
attcagtttcctgatggtagaaaagaagtgggatatatcacaaaggacaataaatacctg
ataattggaaatgtgatagatgctaaaacaggagaaaatataactgccaagaagtataga
gaacttgacaaagtagatgtttcaaaagtgcctttagatgaagctgtaaaactcaagttt
ggaaaaggaactaaaaagctgataatggtagctgaccctgattgtcctttctgcaagaaa
gcttatcaatacctgaaaaacaaagatgttgaagtttatctattcctatttcctctaaac
attcatccacaggcttatgataagtctgtaaaaattctttgttcaaaagacccagcgaaa
gcctatgacaaggtggaaagtggcaatcaattgcaggtgtctaaatgcaaagaaggggaa
gataagctgaaaaggcatattttaattgccaataaacttggagttagagggacacctttg
tttatagatatgcagggacacaaaataaatggtttaaacattccagagcttgaggaggca
ttgaaatga

DBGET integrated database retrieval system