KEGG   Pseudomonas mendocina ymp: Pmen_0070Help
Entry
Pmen_0070         CDS       T00510                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmen_0070
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmen_0070
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmen_0070
Enzymes [BR:pmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pmen_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(67576..68385)
Genome map
AA seq 269 aa AA seqDB search
MSRLQNRFAELKAENRAALVTFVTAGDPDYATSLSILKGLPEAGADVIELGMPFTDPMAD
GPAIQLANIRALAGKQGMQQTLQMVREFRAGNQSTPLVLMGYYNPIFVYGVERFISDAKE
AGVDGLIVVDLPPEHNDELCEPAQSAGLDFIRLTTPTTDDDRLPTVLAGSSGFVYYVSVA
GVTGAGAATLDHVEEAVARLRRHTDLPVCIGFGIRTPEHAAEVAKRAEGAVVGSALIDKI
AEAKSPQQAIDGVLGLCRELAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagaaccgtttcgccgaactgaaagcggaaaaccgcgccgcgctggtg
accttcgtcaccgccggtgatcccgactacgccacctcgctgagcattctcaagggcctg
ccggaggccggcgccgacgtgatcgagctgggcatgcccttcaccgacccgatggccgac
ggcccggccatccagctcgccaacatccgcgcactggccggcaagcagggcatgcagcag
acgctgcagatggttcgcgaattccgcgccggcaaccagagcacgccgctggtgctgatg
ggctactacaacccgatcttcgtctacggcgtcgagcgcttcatcagcgacgccaaagag
gccggcgtcgacggcctgatcgtggtcgacctgccgccggagcacaacgacgagctgtgc
gaaccggcgcagagcgcaggtctggatttcatccgcctgactaccccgaccaccgacgac
gaccgcctgcccaccgtgctggccggcagctccggcttcgtctactacgtgtcggtggcc
ggtgtcaccggcgccggtgcggcgaccctggatcatgtcgaggaagccgtggcgcgcctg
cgtcgccacaccgacctgcccgtttgcatcggcttcggcatccgcaccccggagcacgcc
gccgaagtggccaagcgcgccgagggcgcggtggtcggctcggcgctgatcgacaagatc
gccgaggcgaagagcccgcagcaggccatcgacggcgtactcggcctgtgccgcgaactg
gccgaaggggtacgcggcgcgcgccgctga

DBGET integrated database retrieval system