KEGG   Pseudomonas mendocina ymp: Pmen_0071Help
Entry
Pmen_0071         CDS       T00510                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmen_0071
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmen_0071
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmen_0071
Enzymes [BR:pmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pmen_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(68382..69617)
Genome map
AA seq 411 aa AA seqDB search
MTAMPGSQNSFRTGPDARGLFGRFGGQFVAETLMPLINSLAAEYEKAKSDPAFLEELAYF
QRDYIGRASPLYYAERLSQHFGGAKIYLKREDLNHTGAHKINNCIGQILLAKRMGKQRII
AETGAGMHGVATATVAARFGMQCVVYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLK
DAMNEALRDWVTNVHNTFYLIGTAAGPHPYPAMVRDFQSVIGNEVREQILAKEGRLPDSL
VACIGGGSNAIGLFHPFLDDEGVQIIGVEAAGHGIDTGKHAASMAGGAPGVLHGNRTFLL
QDEDGQITDAHSISAGLDYPGVGPEHAWLHEIKRVEYVPISDDEALEAFHHCCRLEGIIP
ALESAHALAEAFKRAPKLPKDHLMVINLSGRGDKDMQTVMHHMQDNQEKHA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatgcctggttcacagaattctttccgcaccggccccgacgctcgcggcctg
ttcggccgcttcggcggtcagttcgtcgccgaaaccctgatgccgctgatcaactcgctg
gccgccgaatacgaaaaggccaagagcgatccggccttcctcgaagaactggcctacttc
cagcgcgactacatcggtcgcgccagcccgctttactacgccgagcgcctgagccagcac
ttcggcggcgcgaagatctacctcaagcgcgaagacctgaaccacaccggcgcgcacaag
atcaacaactgcatcggccagatcctcctggccaagcgcatgggcaagcagcgcatcatc
gccgagaccggcgccggcatgcacggcgtggccaccgccaccgtggccgcgcgcttcggc
atgcagtgcgtggtgtacatgggcaccaccgacatcgaccgccagcaggccaacgtcttt
cgcatgaagctgctcggcgccgaggtaattccggtcaccgccggcaccggcaccctcaag
gacgccatgaacgaggccctgcgcgactgggtgaccaacgtccacaacaccttctacctg
atcggcaccgccgccggcccgcacccgtacccggccatggtccgcgacttccagtcggtg
atcggcaacgaagtgcgtgagcagatcctggcgaaggaagggcgtctgcccgactcgctg
gtggcctgcatcggtggtggctccaacgccatcggcctgttccaccccttcctcgatgat
gaaggcgtgcagatcatcggcgtcgaggcggccggccacggcatcgacaccggcaagcat
gcggcgagcatggccggcggcgcgccgggcgtgctgcacggcaaccgcaccttcctgctg
caggacgaggacggccagatcaccgatgcccactcgatttccgccggcctcgattacccc
ggcgtcggcccggaacacgcctggttgcacgagatcaagcgcgtcgaatacgtgccgatc
agcgatgacgaagccctcgaagccttccaccactgctgccgcctggaaggcatcatcccg
gccctggaaagcgctcatgcgctggccgaagccttcaagcgtgcgccgaaactgcccaag
gatcacctgatggtgatcaacctgtccggtcgtggcgacaaggacatgcagaccgtgatg
caccacatgcaggacaaccaggagaaacacgcatga

DBGET integrated database retrieval system