KEGG   Pseudomonas mendocina ymp: Pmen_0139Help
Entry
Pmen_0139         CDS       T00510                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00220  Arginine biosynthesis
pmy00250  Alanine, aspartate and glutamate metabolism
pmy00471  D-Glutamine and D-glutamate metabolism
pmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pmen_0139
   00220 Arginine biosynthesis
    Pmen_0139
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Pmen_0139
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Pmen_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase PTPA DUF4952
Motif
Other DBs
NCBI-ProteinID: ABP82913
JGI: Pmen0139
UniProt: A4XNJ7
Position
complement(139457..140365)
Genome map
AA seq 302 aa AA seqDB search
MQALLTEILDEVRPLIGQGKVADYIPALAGVVPDQLGIAVYGNDGQLHVAGDARTPFSIQ
SISKVFSLVQAIGHSGEAIWQRLGHEPSGQPFNSLVQLEFERGKPRNPFINAGALVICDI
NQSRYAAPALSMRDFVRRLSGNPEVTVDNHVAESEYQHRARNAAAAYLMQSFGNFHNEVE
AVLRSYFSCCALRMSCVDLARAFGFLANQGFCQHSGEQILSPRQSKQINAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGQFSVCVWSPELNAAGNSLTGIKALELLSERIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgctgttgactgaaatcctcgacgaggtccgcccgctgatcggccagggcaag
gtggccgactacattcccgcgctggccggcgtggtgcccgatcagctgggcatcgccgtg
tacggcaacgatggccagttgcacgtggccggcgatgcgcgcacgccgttttcgatccag
agcatttccaaggtgttcagcctggtacaggccatcggccacagtggcgaggccatctgg
cagcgcctcggccacgagccgtccgggcagccgttcaattcgctggtgcagctggaattc
gagcgtggcaaaccgcgcaacccgttcatcaacgccggcgccctggtcatctgcgacatc
aaccagtcgcgctatgccgcaccggcactgtcgatgcgcgacttcgtccggcgcctgtcg
ggcaaccccgaggtgacggtggacaaccacgtcgccgaatcggaataccagcaccgtgcg
cgcaacgccgcggcggcctacctgatgcagtcgttcggcaatttccacaacgaggtggag
gcggtgctgcgcagctacttcagctgctgcgcgctgcgcatgagctgcgtggacctggcg
cgtgccttcggctttctggccaaccagggtttctgccagcacagcggcgagcagattctc
tcgccgcgacagagcaagcaaatcaacgccatcatggccaccagtgggctgtacgacgaa
gcgggcaacttcgcctaccgcgtcggcctgcccggcaagagcggcgtcggtggcggcatc
gtcgcggtggtgccggggcagttcagcgtgtgcgtgtggtcgccggaactcaatgcagcc
ggtaattccctgaccgggatcaaggcactggaactgctcagcgaacgcatcggctggtcg
gtgttctga

DBGET integrated database retrieval system