KEGG   Pseudomonas mendocina ymp: Pmen_0162Help
Entry
Pmen_0162         CDS       T00510                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pmy  Pseudomonas mendocina ymp
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
161388..163232
Genome map
AA seq 614 aa AA seqDB search
MICGLWAGGVYGADTEQQEKLERRWELRLDLLRRGLVRSSLAAEGADKAVDQCMQEMRDI
LRRDDMDAALGGLIPRLEKAVLDSEQRRQQRAEEATAALAGLVEQLQRLQPPREVRKALK
SLGKQLQAAVGQQHQLPALLSQLRNLQGQALTVLQAPAQEQPGLLQRLFGSRGDAAEQAQ
PAEQAAAAAGETQQIAAELLDSPAAPVPAPAAALSTAAPAAALSTAAPARSSLAPRAALD
SLPLPPGLVPQPEDEDSPFSLPTSEPGYSAVAPHIASSLRSLLDELELPARHRPQGEALR
LRLEGGLNWYELVPVLDDLAVLVLAVTDSGQREFAGYLKQLNERLEAFLGTLSEAHEGYS
ASVESARSFNQELRDQVTDLQNRVQEAADLEALKQALEQRLDGLLQSVSVHQRQRDSREE
EVAERLQGLVQRVADMEREAQQFREHIEEQRQKSLLDPLTGLPNRAAWSERLELEVARRA
RYGGELLLAVLDVDHFKRINDGYGHLAGDRVLKIIAGELHKRLRKTDFIARFGGEEFVLL
IPATPLEGGMQLLETLRAAIEACPFHFKGEPVTITLSTGLAEFRDGESAEAVFERADQAL
YRAKGNGRNRVELG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgatctgcgggctatgggcaggtggggtttatggagcggatacggagcagcaggaaaag
ctcgagcggcgctgggagctgcgcctggatctgctgcgccgtggcctggtgcgcagcagc
ctggccgccgagggggcggacaaggcggtcgaccagtgcatgcaggagatgcgcgacatc
ttgcgccgcgacgacatggatgccgcgctgggcggtttgattccgcgcctggaaaaggcc
gtactggattcggagcagcgtcgccagcagcgcgccgaagaggcgacggcggcgctggcc
ggcctggtcgagcagctgcagcgcctgcagccgccgcgcgaggtgcgcaaggcgctgaag
agcctcggcaagcagttgcaggccgccgtgggtcagcagcatcagctgccggcgctgctc
agccagctgcgcaacctgcaggggcaggcgctgaccgtgctgcaggcgccggcccaggaa
cagccggggttgttgcagcgcctgttcggcagtcgtggcgatgccgccgaacaggcgcaa
ccggccgaacaggcggctgccgctgctggcgagacgcagcagatcgccgccgaactcctc
gactcgccggccgcgccggtgcccgcgcctgccgccgcgctcagcactgccgcgcctgcc
gccgcgctcagcactgccgcgcctgcacgatcgtcattggcgccgcgggcggcgctggac
agcttgccgttgccgcccggcctggtgccgcagcccgaggatgaggatagccccttctcg
ctgccgaccagcgagccgggctacagcgccgtggcgccgcatatcgccagcagcctgcgc
agcctgctcgatgagctcgaactgccggcccggcatcggccgcagggcgaagccctgcgt
ctgcgcctggaaggtggcctgaactggtacgaactggtgccggtgctggatgacctggcg
gtgctggtgctggccgtgaccgacagcggtcagcgcgaattcgccggctacctcaagcag
ctcaacgagcggctggaagccttcctcggcaccctcagcgaggcgcacgaaggctacagc
gcgtcggtggaaagcgcgcgcagcttcaaccaggagctgcgcgaccaggtcaccgatctg
cagaaccgcgtgcaggaggctgccgatctggaggcactcaagcaggcgctggagcagcgc
ctggacggtctgctgcagagcgtcagcgtgcatcagcgccagcgcgacagtcgcgaggag
gaagtggccgagcgcctgcagggactggtgcagcgtgtcgccgacatggagcgcgaggcg
cagcagtttcgcgaacacatcgaggagcagcggcagaagtccctgctcgatccgctcacc
gggttgcccaaccgggcggcctggagcgagcgcctggagctggaagtggctcgccgcgcg
cgctacggcggggagctgctgctggcggtgctcgacgtcgaccatttcaagcgcatcaac
gacggctacgggcacctggccggcgaccgggtgctgaagatcatcgccggcgaactgcac
aagcgcctgcgcaagaccgacttcatcgcccgtttcggtggcgaggaattcgtgctgctg
attccggccactccgctggagggtggcatgcagttgctggaaaccctgcgcgccgccatc
gaggcctgtccgttccacttcaagggcgagccggtgaccatcaccctctccaccggcctt
gccgaattccgcgacggcgagagcgccgaggcggtattcgagcgtgccgatcaggcgctg
taccgggccaagggcaacggacgcaatcgcgtcgaactgggctga

DBGET integrated database retrieval system