KEGG   Pseudomonas mendocina ymp: Pmen_0171Help
Entry
Pmen_0171         CDS       T00510                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pmen_0171
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Pmen_0171
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pmen_0171
Two-component system [BR:pmy02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Pmen_0171
Bacterial motility proteins [BR:pmy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Pmen_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
172413..173024
Genome map
AA seq 203 aa AA seqDB search
MNEQRIMLRGRPRVPLQALLLGASAGGVEALLQLLVDLPPSYRLPVVCLLHQPDRNDSLL
ADLFARRLQLPVKEAADKEYLRGGVVYVAPAGYHLSIEADRSFSLSREEPRHFSRPSIDI
LFESAADAYGARLAAALLTGANEDGAAGLLAIQRAGGLTLVQDPADAQVPTMPEAALALL
QPDFLLPLTAMRLLLAELDAPPC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcagaggatcatgctgcgtggccgcccccgcgtgcccctgcaggcactgctg
ctgggcgcctccgccggcggcgtggaggcgctgctgcagctgctcgtcgatctgccgccg
agctaccgcctgccggtggtgtgcctgctgcatcagcccgatcgcaacgacagcctgctc
gccgacctgttcgctcggcgcctgcagctgccggtcaaggaggctgcggacaaggaatac
ctgcgcggcggcgtggtctacgtggcgccggccggctatcacctgtccatcgaggcggac
cgcagcttttccctcagtcgcgaggagccgcggcatttctcgcggccgtcgatcgacatt
ctgttcgagtccgctgccgacgcctacggtgcgcggctggctgccgccctgctcaccgga
gccaacgaggacggcgcggccggcctgctggcgatccagcgggccggcggcctgaccctg
gtacaggaccccgccgacgcccaggtcccgaccatgccggaggcggcgctggcgctgctg
caaccggattttctcctgcccctcaccgccatgcgactgctgctggccgaactggatgcc
ccgccatgctaa

DBGET integrated database retrieval system