KEGG   Pseudomonas mendocina ymp: Pmen_0171Help
Entry
Pmen_0171         CDS       T00510                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pmy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pmy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
172413..173024
Genome map
AA seq 203 aa AA seqDB search
MNEQRIMLRGRPRVPLQALLLGASAGGVEALLQLLVDLPPSYRLPVVCLLHQPDRNDSLL
ADLFARRLQLPVKEAADKEYLRGGVVYVAPAGYHLSIEADRSFSLSREEPRHFSRPSIDI
LFESAADAYGARLAAALLTGANEDGAAGLLAIQRAGGLTLVQDPADAQVPTMPEAALALL
QPDFLLPLTAMRLLLAELDAPPC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcagaggatcatgctgcgtggccgcccccgcgtgcccctgcaggcactgctg
ctgggcgcctccgccggcggcgtggaggcgctgctgcagctgctcgtcgatctgccgccg
agctaccgcctgccggtggtgtgcctgctgcatcagcccgatcgcaacgacagcctgctc
gccgacctgttcgctcggcgcctgcagctgccggtcaaggaggctgcggacaaggaatac
ctgcgcggcggcgtggtctacgtggcgccggccggctatcacctgtccatcgaggcggac
cgcagcttttccctcagtcgcgaggagccgcggcatttctcgcggccgtcgatcgacatt
ctgttcgagtccgctgccgacgcctacggtgcgcggctggctgccgccctgctcaccgga
gccaacgaggacggcgcggccggcctgctggcgatccagcgggccggcggcctgaccctg
gtacaggaccccgccgacgcccaggtcccgaccatgccggaggcggcgctggcgctgctg
caaccggattttctcctgcccctcaccgccatgcgactgctgctggccgaactggatgcc
ccgccatgctaa

DBGET integrated database retrieval system