KEGG   Pseudomonas mendocina ymp: Pmen_0281Help
Entry
Pmen_0281         CDS       T00510                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pmen_0281
Enzymes [BR:pmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pmen_0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
289571..290344
Genome map
AA seq 257 aa AA seqDB search
MSAWRLLLTRPAEDCAALAQTLAEHGITGSCMPLLGIEPLPETAEQRIAFAELQRYCAVI
VVSKPAARLGLALLDGHRAEPVTGQPWFAVGAATAALLTEHGLPVHYPERGDDSEALLAL
PALQGALAAESAPRVLILRGEGGREFLGQCLRGQGASVDYLPLYRRVLPPYPAGELSRRV
QAERLNGLVVSSGQGFEHLLQLAGDDWPALARLPLFVPSPRVAEQARAAGAQIVVDCRGA
SAAALLAALEQFPAAAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcctggcgcctgctgctgacccgtcctgcagaggactgtgcggcgctggcgcaa
acgctggccgaacacggcatcaccggcagctgcatgcccttgctgggtatcgagccgctg
cccgagacggccgagcagcgcatcgccttcgccgaactgcaacgctactgcgcggtcatc
gtggtcagcaaacctgctgcgcgcctcggcctggcgctgctggatggtcaccgcgccgag
ccagtgaccggtcagccctggttcgccgtcggggccgccacggcagcgctgctcaccgag
catggcctgcctgtccactaccccgagcgcggcgacgacagcgaagccctgcttgcgctg
ccggccctgcagggcgcgctggccgccgagtccgcgccgcgggtgctgatcctgcgtggc
gagggtggccgagaattcctcggccaatgcttgcgcggccaaggtgcgagcgtcgactat
ctgccactgtatcgccgcgtcctgccaccatacccggcgggcgaactgagccggcgcgtg
caggcggaacgcctgaacggcctggtggtcagcagtggacagggtttcgagcatctgctg
cagctggctggcgatgactggccggcgttggctcggctacccttgttcgtacccagcccg
cgtgtcgccgaacaggcacgcgctgcgggtgcgcagatcgttgtggactgtcgcggcgcc
agtgccgcggccttgctggcagccctggagcagtttccggctgccgccctctaa

DBGET integrated database retrieval system