KEGG   Pseudomonas mendocina ymp: Pmen_0299Help
Entry
Pmen_0299         CDS       T00510                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pmen_0299
Enzymes [BR:pmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pmen_0299
Exosome [BR:pmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pmen_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
306217..307230
Genome map
AA seq 337 aa AA seqDB search
MSVTPANRLFPATRLRRNRRDDFSRRLVREHRLSVDDLILPVFVLDGDNRREAVPSMPGV
ERLSIDLLLQEAEHWVELGIPALALFPVTPLEKKSLDGAEAWNPDGIAQRAIRALRAKFP
ELGVISDVALDPFTTHGQDGILDDSGYVQNDITVDALVKQALSHAEAGAQVVAPSDMMDG
RVQAIREALELADHPNVRIMAYSAKYASAYYGPFRDAVGSAANLGKGNKLGYQMDPANGN
EALHEVAADLAEGADMVMVKPGMPYLDILWRVKDAYKVPTFVYQVSGEYAMHMAAIQNGW
LGEAVILESLTAFKRAGADGILTYFAVRAAELLKQGR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttacccccgccaatcgcctgttccccgccacccgcctgcgccgcaaccgccgc
gacgatttctcccgccgtctggtacgcgaacaccgtctgagcgtcgatgacctgatcctg
ccggtgttcgtcctcgacggcgacaaccgccgcgaagccgtgccgtcgatgccgggcgtc
gagcgcctgtccatcgacctgctgctccaggaagccgaacactgggtcgaactgggcatt
ccggcgctggcgctgttcccggtcaccccgctggagaagaagtccctcgacggcgccgag
gcctggaacccggacggcattgcccagcgcgcgatccgcgccctgcgggcgaaattcccc
gagctcggggtgatcagcgacgtcgccctcgaccctttcaccacccacggtcaggacggc
atcctcgacgactccggctacgtgcagaacgacatcaccgtcgatgccctggtcaagcag
gcgctgtcgcatgccgaggccggtgcccaggtagtggccccctcggacatgatggatggc
cgcgtgcaggcgattcgcgaggcgctggagctggccgaccatcccaacgtgcgcatcatg
gcctactcggccaagtacgccagcgcctactacggtccgttccgcgatgcggtgggctcg
gcggccaacctcggcaagggcaacaagctcggctaccagatggacccggccaacggcaac
gaggcgctgcacgaagtggccgccgacctggccgaaggcgccgacatggtcatggtcaag
cccggcatgccgtatctggacatcctctggcgggtgaaggatgcctacaaggtgcccaca
ttcgtctatcaggtcagtggcgagtacgccatgcacatggcggcgatccagaacggctgg
ctcggcgaggcagtgatcctcgagtcgctcaccgccttcaaacgcgccggtgccgatggc
atcctcacctatttcgccgtacgggcggcagaactgctaaaacaagggcgatga

DBGET integrated database retrieval system