KEGG   Pseudomonas mendocina ymp: Pmen_0381Help
Entry
Pmen_0381         CDS       T00510                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pmen_0381
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmen_0381
  Lipid metabolism
   00071 Fatty acid degradation
    Pmen_0381
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pmen_0381
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pmen_0381
   00626 Naphthalene degradation
    Pmen_0381
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pmen_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
396527..397690
Genome map
AA seq 387 aa AA seqDB search
MHPFSFATTAQILCESGASLRLAELCRERGAQRVLIVTDAGITRLGLLEPLLPGFARAGM
GVQVFDQVLADPPEAVVLAAVAQARELQAELVVGFGGGSSMDVAKLVALLAHPDCAQALS
EIYGVGNARGRRLPLIQVPTTAGTGSEVTPIAIVTTGETTKMGVVSPLLLPDLALLDADL
TLGLPPAVTAATGIDAMVHAIEAYTSALKKNPLSDLLAREALRLLAANLDEVVRNGGNRE
ARQAMLLGACLAGQAFANAPVAAVHALAYPLGGHFHIPHGLSNALVLPQVLAFNAPVAAP
LYAELAPLVLGEQLRAGNAAAQTEQLIEALAAFSQRSGLPTRLRDAGVSEAMLPTLAADA
MLQQRLLVNNPREMNEQQALAIYQAAY
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccttcagcttcgccaccaccgcgcagatcctctgcgaatccggcgccagcctg
cgtctggccgaactgtgccgcgagcgcggcgcacagcgcgtgttgatcgtcaccgatgcc
ggcatcacccgcctgggcctgctggaacccctgctgccgggcttcgcccgcgccggcatg
ggcgtgcaggtgttcgaccaggtgctggccgatccgcccgaggccgtggtgctggccgcc
gtggcccaggcccgcgagctgcaggcggagctggtggtcggtttcggcggcggcagctcg
atggacgtggccaagctggtggccttgctggcgcatcccgactgcgcccaggcgctgagc
gagatttacggcgtgggcaatgcccgcggccggcgcctgccgctgatccaggtgccgacc
accgccggcaccggctcggaggtgacgcctatcgccatcgtcaccaccggcgagaccacc
aagatgggtgtggtttcgccgctgctgctgccggatctggccctgctcgacgccgacctg
accctcggcctgccgcctgcggtcaccgccgccaccggcatcgacgccatggtgcatgcc
atcgaggcctacaccagcgcgctgaagaagaacccgctttccgatctgctggcgcgcgaa
gccctgcgcctgctggcggccaatctcgatgaggtagtgcgcaacggcggcaaccgcgag
gcgcgccaggccatgctgctcggcgcctgcctggccgggcaggccttcgccaacgccccg
gtggcggcggtgcatgcgctggcctaccccctgggcgggcatttccatattccccacggg
ttgtccaacgccctggtgctgccgcaggtgctggcattcaatgcgccggtggccgcgccg
ctgtacgccgaactggcgccgttggtgctgggtgagcagctgcgggccggcaatgccgca
gcgcagaccgagcagttgatcgaggcgctggcagcgttcagccagcgcagcggcctgccg
acccggctgcgtgacgccggggtgagcgaggccatgttgcccacgctggcggcggacgcc
atgctgcagcagcgcctgctggtgaacaatccgcgcgagatgaacgagcagcaggcgctg
gccatttaccaggctgcttattga

DBGET integrated database retrieval system