KEGG   Pseudomonas mendocina ymp: Pmen_0381Help
Entry
Pmen_0381         CDS       T00510                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00010  Glycolysis / Gluconeogenesis
pmy00071  Fatty acid degradation
pmy00350  Tyrosine metabolism
pmy00625  Chloroalkane and chloroalkene degradation
pmy00626  Naphthalene degradation
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmen_0381
  Lipid metabolism
   00071 Fatty acid degradation
    Pmen_0381
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pmen_0381
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pmen_0381
   00626 Naphthalene degradation
    Pmen_0381
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pmen_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PGDH_C
Motif
Other DBs
NCBI-ProteinID: ABP83154
JGI: Pmen0381
UniProt: A4XP88
Position
396527..397690
Genome map
AA seq 387 aa AA seqDB search
MHPFSFATTAQILCESGASLRLAELCRERGAQRVLIVTDAGITRLGLLEPLLPGFARAGM
GVQVFDQVLADPPEAVVLAAVAQARELQAELVVGFGGGSSMDVAKLVALLAHPDCAQALS
EIYGVGNARGRRLPLIQVPTTAGTGSEVTPIAIVTTGETTKMGVVSPLLLPDLALLDADL
TLGLPPAVTAATGIDAMVHAIEAYTSALKKNPLSDLLAREALRLLAANLDEVVRNGGNRE
ARQAMLLGACLAGQAFANAPVAAVHALAYPLGGHFHIPHGLSNALVLPQVLAFNAPVAAP
LYAELAPLVLGEQLRAGNAAAQTEQLIEALAAFSQRSGLPTRLRDAGVSEAMLPTLAADA
MLQQRLLVNNPREMNEQQALAIYQAAY
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccttcagcttcgccaccaccgcgcagatcctctgcgaatccggcgccagcctg
cgtctggccgaactgtgccgcgagcgcggcgcacagcgcgtgttgatcgtcaccgatgcc
ggcatcacccgcctgggcctgctggaacccctgctgccgggcttcgcccgcgccggcatg
ggcgtgcaggtgttcgaccaggtgctggccgatccgcccgaggccgtggtgctggccgcc
gtggcccaggcccgcgagctgcaggcggagctggtggtcggtttcggcggcggcagctcg
atggacgtggccaagctggtggccttgctggcgcatcccgactgcgcccaggcgctgagc
gagatttacggcgtgggcaatgcccgcggccggcgcctgccgctgatccaggtgccgacc
accgccggcaccggctcggaggtgacgcctatcgccatcgtcaccaccggcgagaccacc
aagatgggtgtggtttcgccgctgctgctgccggatctggccctgctcgacgccgacctg
accctcggcctgccgcctgcggtcaccgccgccaccggcatcgacgccatggtgcatgcc
atcgaggcctacaccagcgcgctgaagaagaacccgctttccgatctgctggcgcgcgaa
gccctgcgcctgctggcggccaatctcgatgaggtagtgcgcaacggcggcaaccgcgag
gcgcgccaggccatgctgctcggcgcctgcctggccgggcaggccttcgccaacgccccg
gtggcggcggtgcatgcgctggcctaccccctgggcgggcatttccatattccccacggg
ttgtccaacgccctggtgctgccgcaggtgctggcattcaatgcgccggtggccgcgccg
ctgtacgccgaactggcgccgttggtgctgggtgagcagctgcgggccggcaatgccgca
gcgcagaccgagcagttgatcgaggcgctggcagcgttcagccagcgcagcggcctgccg
acccggctgcgtgacgccggggtgagcgaggccatgttgcccacgctggcggcggacgcc
atgctgcagcagcgcctgctggtgaacaatccgcgcgagatgaacgagcagcaggcgctg
gccatttaccaggctgcttattga

DBGET integrated database retrieval system