KEGG   Pseudomonas mendocina ymp: Pmen_0397Help
Entry
Pmen_0397         CDS       T00510                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pmen_0397 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pmen_0397 (pyrB)
Enzymes [BR:pmy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pmen_0397 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(414011..415018)
Genome map
AA seq 335 aa AA seqDB search
MTPLAAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLFDTLRNLEAMAADIFVV
RHADSGAAHFIAEHVCPNLAIINGGDGRHAHPTQGMLDMLTIRRHKGDFENLSVAIVGDI
LHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGLEESYGVRVFSDANEGLKDVDVVIMLR
LQRERMQGGLLPSEGEFYRLFGLTEQRLKLAKPDALVMHPGPINRGVEIESAVADGPQSV
ILNQVTYGIAIRMAVLSMAMSGQNAQRQLNAEEAN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacgccactcgccgccaagcgcccgctgcaactgaatgaccaaggtcagttgcgccac
ttcctctcactcgacggcctgccccgcgagctgttgaccgaaatcctcgacaccgccgac
tccttcctcgaagtcggcgcgcgcgcggtgaagaaagtcccgctgctgcgcggcaagacc
gtgtgcaatgtgttcttcgagaattccacgcgcacccgcaccaccttcgagctggccgcc
cagcgcctgtcggccgacgtcatcagcctcaacgtctccaccagctccaccagcaagggc
gagacgctgttcgacaccctgcgcaacctcgaagccatggccgccgacatcttcgtcgtg
cgacatgccgactccggcgccgcgcacttcatcgccgagcacgtgtgcccgaacctggcg
atcatcaacggcggcgacggtcgtcacgcgcatccgacccagggcatgctcgacatgctc
accatccgccgccacaagggcgacttcgaaaacctctcggtggccatagtcggcgatatc
ctgcactcgcgggtggcgcgctcgaacatgttggcgctgaagaccctgggctgcccggac
atccgcgtgatcgcgccgaagaccctgctgcccatcggcctggaagaaagctacggcgtg
cgtgtgttcagcgatgccaacgaaggcctcaaggacgtcgacgtggtgatcatgctgcgt
ctgcagcgcgagcgcatgcagggcggcctgctgcccagcgagggtgagttctaccgcctg
ttcggcctcaccgagcagcgcctcaagctggccaaacccgatgccctggtgatgcacccg
gggccaatcaaccgtggcgtggagatcgagtcggcagtggctgacggcccgcagtcggtg
atcctcaaccaggtcacctacggcatcgccatccgcatggctgtgctgtccatggccatg
agcgggcagaacgcccaacgtcaactcaacgccgaggaggccaactga

DBGET integrated database retrieval system