KEGG   Pseudomonas mendocina ymp: Pmen_0575Help
Entry
Pmen_0575         CDS       T00510                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00010  Glycolysis / Gluconeogenesis
pmy00020  Citrate cycle (TCA cycle)
pmy00620  Pyruvate metabolism
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01200  Carbon metabolism
Module
pmy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmen_0575
   00020 Citrate cycle (TCA cycle)
    Pmen_0575
   00620 Pyruvate metabolism
    Pmen_0575
Enzymes [BR:pmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pmen_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H E3_binding RnfC_N HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ABP83345
JGI: Pmen0575
UniProt: A4XPS9
Position
complement(628304..630274)
Genome map
AA seq 656 aa AA seqDB search
MSELIRVPDLGGEGEVIELLVKVGDRIEAEQSVLTLESDKASMEVPSPKAGVVKEIKVKI
GDRLKEGDELLVLEVEGAAQAAPAPKAEAAPAQAPQAAAPAAAPAAAATGSSVQDVHVPD
IGSSAKGKVIEIMVKVGDRIEADQSLLTLESDKASMEIPAPAAGVVEQVLVKLDDEIGTG
DLILKLKVEGAAPAAAAPAAAPAQAAAPAAAPAPAAAPSGSSVQDVRVPDIGSSAKGKVI
EIMVKAGDSIEADQSLLTLESDKASMEIPSPAAGVVEEVLVKLDDEIGTGDLILKLKVAG
SASAPAPAQASQEVHRVPEGAAPEVAAEVRAIASLSAAAAEVANAPKRDGAKVHAGPAVR
QLARDFGVELADIAGTGPKGRILKEDVQAYVKAMMHKAKAAPQAAAAATGGAGIPPIPAV
DFSKFGEIEEVAMTRLMQVGAANLHRSWLNVPHVTQFDSADITDLEAFRVAQKAVAEKAG
VKLTVLPLLLKACAHLLKELPDFNSSLAPSGKALIRKKYVHIGFAVDTPDGLLVPVIKNV
DQKSLLQLAGEAAALADKARTKKLSADDMQGACFTISSLGHIGGTGFTPIVNAPEVAILG
VSKATMQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTQRLSQLLADIRTILL
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattgattcgcgtacccgacctcggcggtgaaggcgaggtgattgaactgctg
gtcaaggtcggcgaccgtatcgaagccgagcagagcgtactgaccctggagtccgacaag
gcctccatggaagtgccctcgcccaaggccggcgtggtcaaggaaatcaaggtcaagatc
ggcgaccgcctgaaggaaggcgacgagctgctggtgctggaagtcgaaggggctgcgcaa
gccgcaccggcgccgaaagccgaagctgcgcctgcccaggccccgcaagcggccgctccg
gcagccgcacccgccgccgctgccaccggcagcagcgtgcaggacgtgcacgtaccggac
atcggctccagcgccaagggcaaggtcatcgagatcatggtcaaggtcggcgaccgcatc
gaagccgaccagagcctgctgaccctggagtccgacaaggcctccatggaaatccccgca
ccggctgccggcgtggtggagcaggtgctggtcaagctggacgacgagatcggcactggc
gacctgatcctcaagctcaaggtcgaaggcgctgcccccgcagctgctgccccggcagcc
gctcctgcgcaggccgccgcacccgctgccgcccctgcaccggccgccgcgccgagcggc
agcagcgtgcaggacgtacgtgtgccggacatcggctccagcgccaagggcaaggtcatc
gagatcatggtcaaggctggcgacagcatcgaagccgaccagagcctgctgaccctggaa
tccgacaaggcctccatggaaatcccctcgccggctgccggcgtggtggaagaagtgctg
gtcaagctggatgacgagatcggcaccggcgacctgattctcaagctcaaggtagccggc
tctgcttctgcacccgccccggcgcaagccagccaggaagtgcaccgtgtgccggaaggt
gcggcgccggaagtggccgccgaagtgcgcgccatcgcctcgctgtcggctgctgccgcc
gaagtcgccaatgcgcccaagcgcgatggcgccaaggtgcatgccggcccggccgtgcgt
cagctggcccgcgatttcggcgtggaactggcggatatcgccggcaccggcccgaaaggt
cgcatcctcaaggaagacgtgcaggcgtacgtcaaggcgatgatgcacaaggccaaggcc
gcgccgcaggcagctgcagccgctaccggcggcgccggcattccgccgatcccggccgtg
gacttcagcaagttcggtgaaatcgaagaagtggcgatgacccgcctgatgcaggtcggc
gccgccaacctgcaccgcagctggctcaacgtgccacacgtgacccagttcgactcggcc
gacatcaccgacctggaagccttccgcgtcgcgcagaaggccgtggcggaaaaggccggc
gtcaagctgaccgtgctgccgctgctgctcaaggcctgtgcccacctgctcaaggaactg
ccggacttcaacagttcgctggccccgagcggcaaggcgctgatccgcaagaagtacgtg
catatcggcttcgccgtcgatacgccggacggcctgctggtgccggtgatcaagaacgtc
gaccagaagagcctgctgcagctggccggcgaagccgccgcactggccgacaaggcccgc
accaagaagctctcggctgatgacatgcagggcgcctgcttcaccatctccagcctcggc
cacattggcggcaccggcttcacgccgatcgtcaacgcgccggaagtggcgattctcggt
gtgagcaaggccaccatgcagccggtgtgggacggcaaggccttccagcccaagctgatg
ctgccgctgtcgctgtcctacgaccaccgggtgatcaatggcgctgccgcggcgcgcttc
acccagcgtctgtcgcagctgctggccgacatccgcaccatcctgctgtaa

DBGET integrated database retrieval system