KEGG   Pseudomonas mendocina ymp: Pmen_1147Help
Entry
Pmen_1147         CDS       T00510                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmen_1147 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmen_1147 (glk)
   00052 Galactose metabolism
    Pmen_1147 (glk)
   00500 Starch and sucrose metabolism
    Pmen_1147 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Pmen_1147 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pmen_1147 (glk)
   00524 Butirosin and neomycin biosynthesis
    Pmen_1147 (glk)
Enzymes [BR:pmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pmen_1147 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1292143..1293102
Genome map
AA seq 319 aa AA seqDB search
MKPSLVGDIGGTNARFALWRDERLEAVRVLVTADFADPQLAIAHYLAEQGLASGDIAALC
LAVAGPVKGEHFRFTNNHWQFARSELAAFLHLQPADLLVINDFTAMALGMTRLRPQERLE
ICPGVVEEDCPAVVIGPGTGLGVGTLLPLGGGHWRALPGEGGHVDLPIATPREAQLWQAL
HAQLGHVRAEDVLSGSGLLRLYRALCTVDGHPALLSSPAQVTAAALAGDALASSVLEQFC
VWLGRAAGNCVLTLGARGGVYIVGGVVPRFADFFRSSGFARGFAEKGSMSRYLDGVPVWL
VTAEYPGLEGAGVALQERT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgtcactggtaggggatatcggcggcaccaatgcacgcttcgcgctgtggcgc
gacgaacgtctggaggcggtgcgggtgctggtcaccgccgacttcgccgatccgcaactg
gccatcgcccattatctggccgagcagggcctggcctcgggcgacatcgccgcactctgc
ctggcggtggccgggccggtgaagggcgagcatttccgcttcaccaacaaccactggcag
ttcgcccgcagcgagctggccgccttcctgcacctgcagcctgccgacctgctggtgatc
aacgatttcaccgccatggccctgggcatgacccgcctgcgtccgcaggagcggctcgag
atctgcccgggcgtggtggaggaggactgtccggcggtggtcatcgggccgggcaccggt
ctgggcgtaggtaccctgctgcccctcggtggcgggcactggcgcgcgctgccgggcgaa
ggcgggcatgtcgacctgcccatcgccaccccgcgcgaggcgcagctgtggcaggcgctg
catgcccagctcggccatgtgcgcgccgaagacgtactcagtggcagcggcctgctgcgc
ctgtatcgtgcgctctgcactgtggatggacacccagcgctgctaagctccccggcgcag
gttaccgccgccgcgctggcgggcgatgcgctggccagcagcgtgctcgaacagttctgc
gtttggctcggccgcgcggccggcaactgcgtgctgacgctgggcgcacgaggtggggtg
tacatcgtcggcggcgtggtgccgcgcttcgccgatttcttccgcagcagcggcttcgcc
cgtggctttgccgagaagggcagcatgagccgttatctggacggcgtgccggtatggctg
gtgactgccgagtatcccggcctggagggcgcgggggtagccttgcaagagagaacctag

DBGET integrated database retrieval system