KEGG   Pseudomonas mendocina ymp: Pmen_1147Help
Entry
Pmen_1147         CDS       T00510                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00010  Glycolysis / Gluconeogenesis
pmy00052  Galactose metabolism
pmy00500  Starch and sucrose metabolism
pmy00520  Amino sugar and nucleotide sugar metabolism
pmy00521  Streptomycin biosynthesis
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmen_1147
   00052 Galactose metabolism
    Pmen_1147
   00500 Starch and sucrose metabolism
    Pmen_1147
   00520 Amino sugar and nucleotide sugar metabolism
    Pmen_1147
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pmen_1147
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pmen_1147
Enzymes [BR:pmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pmen_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABP83914
JGI: Pmen1147
UniProt: A4XRE8
Position
1292143..1293102
Genome map
AA seq 319 aa AA seqDB search
MKPSLVGDIGGTNARFALWRDERLEAVRVLVTADFADPQLAIAHYLAEQGLASGDIAALC
LAVAGPVKGEHFRFTNNHWQFARSELAAFLHLQPADLLVINDFTAMALGMTRLRPQERLE
ICPGVVEEDCPAVVIGPGTGLGVGTLLPLGGGHWRALPGEGGHVDLPIATPREAQLWQAL
HAQLGHVRAEDVLSGSGLLRLYRALCTVDGHPALLSSPAQVTAAALAGDALASSVLEQFC
VWLGRAAGNCVLTLGARGGVYIVGGVVPRFADFFRSSGFARGFAEKGSMSRYLDGVPVWL
VTAEYPGLEGAGVALQERT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgtcactggtaggggatatcggcggcaccaatgcacgcttcgcgctgtggcgc
gacgaacgtctggaggcggtgcgggtgctggtcaccgccgacttcgccgatccgcaactg
gccatcgcccattatctggccgagcagggcctggcctcgggcgacatcgccgcactctgc
ctggcggtggccgggccggtgaagggcgagcatttccgcttcaccaacaaccactggcag
ttcgcccgcagcgagctggccgccttcctgcacctgcagcctgccgacctgctggtgatc
aacgatttcaccgccatggccctgggcatgacccgcctgcgtccgcaggagcggctcgag
atctgcccgggcgtggtggaggaggactgtccggcggtggtcatcgggccgggcaccggt
ctgggcgtaggtaccctgctgcccctcggtggcgggcactggcgcgcgctgccgggcgaa
ggcgggcatgtcgacctgcccatcgccaccccgcgcgaggcgcagctgtggcaggcgctg
catgcccagctcggccatgtgcgcgccgaagacgtactcagtggcagcggcctgctgcgc
ctgtatcgtgcgctctgcactgtggatggacacccagcgctgctaagctccccggcgcag
gttaccgccgccgcgctggcgggcgatgcgctggccagcagcgtgctcgaacagttctgc
gtttggctcggccgcgcggccggcaactgcgtgctgacgctgggcgcacgaggtggggtg
tacatcgtcggcggcgtggtgccgcgcttcgccgatttcttccgcagcagcggcttcgcc
cgtggctttgccgagaagggcagcatgagccgttatctggacggcgtgccggtatggctg
gtgactgccgagtatcccggcctggagggcgcgggggtagccttgcaagagagaacctag

DBGET integrated database retrieval system