KEGG   Pseudomonas mendocina ymp: Pmen_1264Help
Entry
Pmen_1264         CDS       T00510                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pmy  Pseudomonas mendocina ymp
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1425048..1426115)
Genome map
AA seq 355 aa AA seqDB search
MSQPPKPPSIIDLYPEETREAAALLKQAVPLMMRHDIPPNPVHYALWYTYSRGSEPELNR
RLDKVVEDFDVFPPDTASKLFRDYIIRGELEEARAGQQQVIELVDDIEGDVSRSVIGSEN
YQQSLSHGLSALQEPIIDDLPSVLSGLQESTQLMQDQQEKFLYRLRAAQEEITHLRSQLE
RAHLAATLDSLTRVFNRHAFTRLLERALSETHKGLALVILDIDHFKQFNDQYGHPLGDRV
LQHVGQLLRDLLPSGAFAARYGGEEFCVVLRDCVDLGAVLEFAEKLRNKIQALRVKVRRT
DQVLDSITASFGCALAEADDSLETLLTRADDALYQAKRSGRNQVHPITSKTVLSA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagccgcccaaaccgcccagcatcatcgacctgtatcccgaggagacccgcgag
gcagcggcgctgctcaagcaggccgtgccattgatgatgcgccacgatatcccgcccaat
ccggtgcactatgcactctggtacacctacagcagaggtagcgagccggagctcaaccgt
cgcctggacaaggtcgtcgaggatttcgacgtgttcccgccggataccgccagcaaactc
tttcgcgactacatcattcgcggcgagctggaggaagcccgtgccggccagcagcaggtg
atcgaactggtcgatgacatcgagggtgacgtttcccgcagcgtgatcggcagcgagaac
tatcagcagagcctcagtcatgggctaagcgccctgcaggaaccgatcatcgacgacctg
cccagcgtgctcagcggtttgcaggaaagcacccagctgatgcaggaccagcaggagaag
tttctctaccgcctgcgcgccgcccaggaggaaatcacccacctgcgcagtcagctcgag
cgggcgcacctggctgcaacgctcgacagcctgacccgcgtgttcaaccgacatgccttc
acccgcctgctggaacgcgccctgagcgaaacccacaagggcctggcgctggtcattctc
gatatcgaccacttcaaacagttcaacgaccagtacggccacccgctgggtgatcgggtg
ttgcagcacgttggccaactgttgcgcgaccttctaccatcaggcgcctttgccgcccgt
tatggtggcgaggaattttgcgtggtactgcgcgactgcgtcgacctgggagcggttctc
gaatttgccgaaaaactacgcaacaagatccaggcgctgcgggtcaaggtacgccgtacc
gatcaggtgctcgacagcattaccgcctccttcggctgcgccctggccgaggcggacgac
agcctggaaacactgctgacccgcgccgacgacgcgctctatcaggccaagcgcagtggc
cgcaaccaggttcacccgattaccagcaaaaccgtgctaagcgcttga

DBGET integrated database retrieval system