KEGG   Pseudomonas mendocina ymp: Pmen_1271Help
Entry
Pmen_1271         CDS       T00510                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pmen_1271
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pmen_1271
DNA repair and recombination proteins [BR:pmy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pmen_1271
    RecFOR pathway proteins
     Pmen_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1432351..1432959
Genome map
AA seq 202 aa AA seqDB search
MVIGRLRGTLAEKQPPHLLLDVNGVGYELEVPMTTLYRLPAVGETLTLHTHQVVREDAHL
LYGFFEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTAALTKVPGVGKK
TAERLLVELKDRFKAWETMPAIATLVVEPRLGATVSSAENDAVSALISLGYKPQEASRAV
AAVKEDGLSSEDLIRRALRGMA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcggacgtttgcgcggcaccctggcggaaaagcagccgccgcatttgcttctg
gatgtaaatggcgtcggttatgagctggaagtgccgatgaccaccctatatcgtctgcct
gcggtgggggagacgctgacgctgcacacccatcaggtggtgcgcgaagacgcccatctg
ctctacggatttttcgagaagcgcgagcgcgagctgttccgcgagctgatccgcctcaat
ggcgtcggcccgaagctggcgctggccttgatgtccggactggaggtcgacgagctggtg
cgctgcgtgcaagcccaggacacggcggcgctgaccaaggtgcccggcgtcggcaagaag
accgccgagcggctgctggtggaactcaaggacaggttcaaggcctgggagaccatgccg
gccatcgccaccctggtggttgaacctcgcctgggggcgacagtctcaagcgcggagaac
gatgcggtgagcgctctgatttccctcggctacaagccgcaggaggccagccgggccgtg
gctgccgtcaaggaggatggcttgagtagtgaagatttgattcgtcgcgcgttgcgcggc
atggcgtag

DBGET integrated database retrieval system