KEGG   Pseudomonas mendocina ymp: Pmen_1590Help
Entry
Pmen_1590         CDS       T00510                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pmen_1590
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Pmen_1590
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pmen_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1752554..1753564
Genome map
AA seq 336 aa AA seqDB search
MTTPIQGSLMLDIAGTWLTAEDRQLLRQPEVGGLIIFARNIESPRQVRELCQSIRALRPD
LLLAVDQEGGRVQRLRQGFLRLPAMRAIADNDNAEELAEHCGWLMATEVMAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGDPQRAAALAAAFIRGMHQAGMAATGKHFPGHGWAEADSHVA
IPMDGRSLDEIRACDMQPFQRLVVELDAVMPAHVIYPQVDEHPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAGQRIQAALTAGCDMGLVCNDRASAELALSALQRLRVTPP
ARLERMRGRGHATTEYRQAPRWLTAVAALRAAQLLD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacacctattcaaggctctttgatgctggacatcgccggtacctggttgaccgcc
gaagaccgccagctgctgcgccagcccgaagtgggcggcctgatcatcttcgctcgcaat
atcgaatcgccgcgccaggtgcgcgagctgtgtcagagcatccgcgcgctgcgtccagac
ctgctgctggcggtggatcaggaaggcgggcgggtgcagcgtctgcgtcagggtttcctg
cgattgccggcgatgcgtgccattgccgataacgacaatgccgaggagctggccgaacat
tgcggttggctgatggccaccgaggtaatggcggtgggcctggacctgagtttcgcgcca
gtgctggatctcgaccaccagcgcagtgcggtggtcggcagtcgcgccttcgagggtgat
ccgcagcgcgccgccgcgctggcggcggccttcattcggggtatgcatcaggcgggcatg
gctgccaccggcaagcattttcccggccacggttgggccgaggccgactcgcacgtggcc
atcccgatggacgggcgcagcctggatgagatccgtgcctgcgacatgcagccgttccag
cgtctggtcgttgagctggatgcggtgatgcctgcccatgtcatctatccgcaggtggat
gagcacccggccggcttttcgcggcgctggctgcaagacatcctgcgcggcgagctgggc
ttcgacggcgtgatcttcagcgatgacctgtccatggccggtgcccatgtggtcggcgat
gccggccagcgtatccaggccgccctgactgcaggctgcgatatggggctggtgtgcaac
gaccgcgcttcggccgagctggcgctcagtgccttgcagcgtctgcgcgtgacaccgccg
gcgcgcctcgagcggatgcgtggccgtggtcacgccactaccgaataccgccaggcgcca
cgctggcttaccgctgtggcggccctcagagctgcccagttgctcgactga

DBGET integrated database retrieval system