KEGG   Pseudomonas mendocina ymp: Pmen_1762Help
Entry
Pmen_1762         CDS       T00510                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00480  Glutathione metabolism
pmy00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pmen_1762
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pmen_1762
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pmen_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABP84526
JGI: Pmen1762
UniProt: A4XT60
Position
1936288..1936839
Genome map
AA seq 183 aa AA seqDB search
MSLHRLACSLLLSSLALPVLAAECPALLQGELPKLRAKGESVELCQFAGKPLVVVNTASF
CGFTPQFKGLEALYQRYKDQGLEVLGVPSDDFRQEADSSEETATVCYVNYGVTFAMTEPQ
PVSGGNAIPLFKGLAEQSRAPRWNFFKYVVDRQGKVVASFSSLTKPDDPELVAAVEKAIA
SQP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttcatcgtcttgcctgctccttgctgctctccagcctggcattgccggtgctg
gccgccgaatgtccggcactgctgcagggagaattgcccaagctgcgcgccaagggtgag
agcgtcgaactctgccagttcgccggcaagccgctggtggtggtcaataccgccagcttc
tgcggcttcaccccgcaattcaaagggctcgaagcgctgtaccagcgttacaaggatcag
ggcctggaagtgctgggcgtgccgtccgacgatttccgtcaggaggccgacagcagcgag
gaaaccgccaccgtctgctacgtcaactacggcgtgaccttcgccatgaccgagccgcag
ccggtttccgggggcaatgccatccccctgttcaagggcctggccgagcagagcagggcg
ccgcgctggaatttcttcaaatatgtggtcgaccgtcagggcaaggtggtggccagtttt
tccagcctgaccaagccggatgaccccgagctggtcgccgcggtggagaaggcaatcgcc
tcgcaaccctga

DBGET integrated database retrieval system