KEGG   Pseudomonas mendocina ymp: Pmen_1884Help
Entry
Pmen_1884         CDS       T00510                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pmy00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2076761..2077297
Genome map
AA seq 178 aa AA seqDB search
MTSLSVHLHSSPNLPNKVLTHAEDIASTLAAVGIAYRQLELPAALRPGCEQAEFEAAYGL
WLQRLMEEGYPHHELFNLQRNHPQKLEMRARHLDEQMQPTASAWLFLGGFAQLSLHLDGY
VYVLQGERGDLLELPAGTRHWFDLGEEPHLLALRLSASDEAPQPTGDDIASRFARLGE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctcagcgttcatctgcacagctccccgaacctgccgaacaaggtgctgacc
catgccgaggacatcgccagcacgctggccgcggtcggtatcgcttaccgccagctggaa
ctgccggcggccttgcgaccgggctgcgagcaggccgagttcgaggcggcctacggcctc
tggctgcagcggctgatggaggaggggtatccgcatcacgagctgttcaacctgcagcgc
aaccatccgcagaagctggagatgcgtgcgcggcatctggacgagcagatgcaaccgacc
gccagtgcctggctgtttctcggcggtttcgcccagctcagcctgcatctggatggctac
gtgtatgtgttgcagggcgagcgtggcgatctgctggaattgcccgcaggcacccgccac
tggttcgacctgggcgaggaaccgcacctgctggcgctgcgcctgagcgccagtgacgag
gcgccacaacccacgggcgatgacatcgccagccgttttgcccgtctgggcgagtga

DBGET integrated database retrieval system