KEGG   Pseudomonas mendocina ymp: Pmen_1884Help
Entry
Pmen_1884         CDS       T00510                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pmen_1884
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Pmen_1884
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Pmen_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2076761..2077297
Genome map
AA seq 178 aa AA seqDB search
MTSLSVHLHSSPNLPNKVLTHAEDIASTLAAVGIAYRQLELPAALRPGCEQAEFEAAYGL
WLQRLMEEGYPHHELFNLQRNHPQKLEMRARHLDEQMQPTASAWLFLGGFAQLSLHLDGY
VYVLQGERGDLLELPAGTRHWFDLGEEPHLLALRLSASDEAPQPTGDDIASRFARLGE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctcagcgttcatctgcacagctccccgaacctgccgaacaaggtgctgacc
catgccgaggacatcgccagcacgctggccgcggtcggtatcgcttaccgccagctggaa
ctgccggcggccttgcgaccgggctgcgagcaggccgagttcgaggcggcctacggcctc
tggctgcagcggctgatggaggaggggtatccgcatcacgagctgttcaacctgcagcgc
aaccatccgcagaagctggagatgcgtgcgcggcatctggacgagcagatgcaaccgacc
gccagtgcctggctgtttctcggcggtttcgcccagctcagcctgcatctggatggctac
gtgtatgtgttgcagggcgagcgtggcgatctgctggaattgcccgcaggcacccgccac
tggttcgacctgggcgaggaaccgcacctgctggcgctgcgcctgagcgccagtgacgag
gcgccacaacccacgggcgatgacatcgccagccgttttgcccgtctgggcgagtga

DBGET integrated database retrieval system