KEGG   Pseudomonas mendocina ymp: Pmen_1987Help
Entry
Pmen_1987         CDS       T00510                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pmen_1987
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pmen_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2190660..2192690
Genome map
AA seq 676 aa AA seqDB search
MSTMLAPALRDRAELFALLSTWSERGWLRELDRALAQLFAELDPDASPLLLLGAALASHQ
LGQGHVCLDLAATLANPDFTLSLPPEGEDAQEALILPSQVLAGLSLESWLAACAGSSLLE
SEGAPLVLSGACLYMRRYWNYERQVAGDIARRLQASAAAPSDLAARLASLFPEPLVVDGQ
RQTDWQKLACAMAAQGRFTLITGGPGTGKTTTVVRLLALLQEAAMATGEPLRLSLAAPTG
KAAARLTESIGAQVQSLALDERVREQIPTLVTTLHRLLGSRPGSRHFRHDAANPLPLDVL
VVDEASMIDLEMMASLLGALPVHARLILLGDKDQLASVEAGAVLGDLCREAESGGYSEAT
RTWLESQTGERLDDPALISGNKALAQHIVMLRHSRRFGSGSGIGRLARAVNQGDAQAARA
TLANGADDLHVLRLSGEQDRALERLLIGGLGEAEPRPQGYAHYLQVMQAQRPAPGADPQA
WDRWAGNVLAAFDQFQLLCAVRKGTWGVEALNERTAEALVRRGLLEQSHGWYEGRPVLVT
RNDYSLGLMNGDIGIALRLPEPPEFPGAPVREVLRVVFPRNDGSGALRHILPSRLGAVET
VFAMTVHKSQGSEFAHCALILPDNLNPVLTKELIYTGITRARHWFSLIESRAGIFEHAVQ
RRVQRRSGLREALEAL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgatgcttgcgccggcgctgcgtgaccgcgccgaactctttgccctgctttct
acctggagcgagcgtggctggctgcgtgagctggatcgggcgctggcgcagctgttcgcc
gaattggatccggacgcttcgcccttgctgctgctcggcgccgcgctggccagccaccaa
ctgggccagggccacgtctgcctcgacctcgcggccacgctggccaatccggatttcacc
ctgtctctgccgccggaaggcgaggacgcgcaagaagcgctgatcctgccgtcccaggtg
ctggccgggctcagtctggagtcctggctggcggcctgtgccggcagctcgctgctggag
tccgaaggtgcgccgctggtgctcagcggcgcctgtctatatatgaggcgttactggaac
tacgagcgtcaggtggctggcgatatcgcccggcgtctgcaggcgagcgctgcagccccg
agcgatctggccgcgcgcctggcttcactctttcccgaaccgctggtggtggacggccag
cgccagaccgactggcagaagctggcctgcgccatggccgcgcaggggcgcttcacgctg
attaccgggggacccggaaccggcaagacgacgacggtggtgcgcctgctggcgctgttg
caggaagccgccatggctactggcgagccgctgcgcctgagcctggcagcgcctaccggc
aaggcagccgcgcggttgaccgaatccatcggcgcgcaggtgcagtccctggcgctggac
gagcgagtgcgtgaacagattccaaccctggtgacgacgctgcatcgtctgctgggcagt
cgtcccggcagccgtcatttccgtcacgatgccgctaaccccttgccactggatgtgctg
gtggtcgacgaagcctcgatgatcgacctggaaatgatggccagcctgctgggcgcgtta
ccggtgcatgcgcgcctgattttgttgggcgacaaggaccaactggcgtcagtggaggcc
ggcgcggtactgggcgacctgtgccgggaggcagaaagcggtggctacagcgaggcgacg
cgtacctggctggaaagccagacgggcgagcggctggacgatccggcgctgatatccggt
aacaaggcgctggcgcagcatatcgtcatgctgcgccactcgcgtcgtttcggcagtggc
tcgggtatcggccgtctggcgcgggcggtgaaccagggggatgcgcaggcggctcgtgcg
actctggcaaacggcgcggacgacctgcatgtgctgcgcctgtccggcgagcaggatcga
gcgctggagcgactgctgatcggcgggctgggcgaagccgagccacgtccgcaggggtat
gcgcattatctgcaggtaatgcaggcgcagcgtcccgccccgggtgctgacccccaggcc
tgggatcgttgggccggtaatgtcctggcagcgttcgatcagttccagctgctctgtgcg
gttcgtaaaggtacttggggtgtcgaagcgctcaatgaacgtaccgctgaagcattggta
cggcgcggcctccttgaacagtcgcatggctggtatgaaggtcggcccgtgctggtaacg
cgcaatgactatagcctggggctgatgaatggcgatatcggcatcgcgctgcgtctgccc
gagccgccggagtttccaggtgcgcctgtacgcgaggtgctgcgcgttgtgttcccgcgc
aacgacggcagtggcgccttgcggcatatcttgcccagtcgtctcggcgcagtggagacc
gtgttcgccatgaccgtgcacaagtcgcagggctcggagttcgcccattgcgcactgatc
ctgcccgacaacctcaatccagtattgaccaaggagctgatctataccggcatcacccgg
gcgcgtcactggttcagcctcatcgagagccgcgccggcatcttcgagcacgccgtacag
cggcgtgtgcagcggcgcagcgggctgcgcgaggcactcgaagcgttatag

DBGET integrated database retrieval system