KEGG   Pseudomonas mendocina ymp: Pmen_2069Help
Entry
Pmen_2069         CDS       T00510                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00071  Fatty acid degradation
pmy00280  Valine, leucine and isoleucine degradation
pmy00281  Geraniol degradation
pmy00310  Lysine degradation
pmy00360  Phenylalanine metabolism
pmy00362  Benzoate degradation
pmy00380  Tryptophan metabolism
pmy00410  beta-Alanine metabolism
pmy00627  Aminobenzoate degradation
pmy00640  Propanoate metabolism
pmy00650  Butanoate metabolism
pmy00903  Limonene and pinene degradation
pmy00930  Caprolactam degradation
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01212  Fatty acid metabolism
Module
pmy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pmen_2069
   00650 Butanoate metabolism
    Pmen_2069
  Lipid metabolism
   00071 Fatty acid degradation
    Pmen_2069
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pmen_2069
   00310 Lysine degradation
    Pmen_2069
   00360 Phenylalanine metabolism
    Pmen_2069
   00380 Tryptophan metabolism
    Pmen_2069
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pmen_2069
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pmen_2069
   00281 Geraniol degradation
    Pmen_2069
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pmen_2069
   00627 Aminobenzoate degradation
    Pmen_2069
   00930 Caprolactam degradation
    Pmen_2069
Enzymes [BR:pmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pmen_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABP84830
JGI: Pmen2069
UniProt: A4XU14
Position
2292088..2292900
Genome map
AA seq 270 aa AA seqDB search
MSDYQAFRVELADKIAHVQINRPDKVNAMNADFWREIIEIFRWVDATDAVRVVVLSGAGK
HFSSGIDLMLLASVGSQLGKDVGRNADALRRKILELQASFNAVDQCRKPVLAAIQGYCLG
GAIDLISACDMRYATVDAQFSIKEIDMGMAADVGTLQRLPRIIGDGMMRELAFTGRSIDG
AEAARIGLVNRTYESQEALLAGVMAIAADIAAKSPVAIRGTKEMIRYMRDHRVDDGLEYI
ATWNAAMLQSEDLRLAMTAHMTKQKPEFAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactatcaagccttccgcgtcgagttggcggacaagatcgcccatgtgcagatc
aaccgcccggacaaggtcaatgcgatgaatgccgacttctggcgcgagatcatcgagatc
ttccgctgggtcgatgccaccgatgcggtgcgggtggtggtgctgtccggtgcaggcaag
cacttttcctccggtatcgatctgatgctgctggcctcggttggttcccagctgggcaag
gatgtcggtcgcaatgccgatgccctgcgccgcaagatcctcgaactgcaggcttccttc
aatgccgtcgaccagtgccgcaagccggttctggccgcgatccagggctactgcctgggt
ggcgccatcgacctgatcagcgcctgcgacatgcgttacgccacggtcgatgcacagttc
tccatcaaggagatcgacatgggcatggcggccgatgtcggtactctgcagcgcctgccg
cgtatcatcggtgacggcatgatgcgcgagctggccttcaccgggcgcagcatcgacggc
gccgaggccgcgcgtattggtttggtcaatcgcacctacgagagccaggaagccctgctg
gccggggtcatggcaatcgccgcggacattgccgccaagtcgccggtggcgattcgcggt
accaaggaaatgattcgctacatgcgtgatcaccgggtcgacgatggcctggagtacatc
gccacctggaacgctgccatgctgcagtcggaagacctgcgtctggccatgacggcgcac
atgaccaagcagaaaccggagttcgccgactga

DBGET integrated database retrieval system