KEGG   Pseudomonas mendocina ymp: Pmen_2279Help
Entry
Pmen_2279         CDS       T00510                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pmen_2279
Enzymes [BR:pmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pmen_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2509548..2511602
Genome map
AA seq 684 aa AA seqDB search
MSDTLLAELAEAAGLYIDWTDAHGRPQTVTPEAQRALLEALGYPAQSPEQIRSSLAMLTQ
QQHVPSPDALLLQDQGQPLPLALYPADSPYRLIDEQGQVFSGRLDADARLPAQPQPGYYQ
LEIRDTRHALAVTPAACLSVSQLCGKPRIWGLTAQLYGLRRPGDGGVGDTQAVAELLRHA
ANQGADALALSPVHALFAADTERFGPYSPSSRLFFNPLHAAPADRLGEERVQRAIQTAGL
QEEMQRLEHLELIDWPAVAKARQRLLWQLYQDFCQAPGDLLADFEAFRAAGGDALQQHCC
FEAIHAQRLREGASGDWRSWPQELRNPLQGAVTRFAAEQADTLRFHAFAQWLIAHGLECA
QATASGAGMGIGLIADLAVGADCAGSQAWSRQDELLPSVTVGAPPDIINRQGQNWGVAAF
SPQGLQRHGFRAYIEMLQANLAHAGGIRIDHVMGLQRLWVIPQGGEAQHGAYLRYPLDDL
LRLLALESHRHRALVIGEDLGTVPDGLREKLAARNILGTRVLLFEQQDGRFIPPAQWSRN
ALATTTTHDLPTIKGWFAGHDIEWRVRAGHADEQSLEQDHAERAGERVALLQALEQRGPL
GGTDDDACLQACIDYIGSTPSALALLPLEDACALEQQPNLPGPGDLHPNWRRRYPLAANE
LLEQPATRRRLACLDTARREAGDE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacgctattggccgaactggccgaggcggccggtctgtacatcgactggacg
gatgcccacggccggccgcaaaccgttaccccggaggcgcagcgcgccctgctggaagcg
ctggggtacccggcgcagagccccgaacagatacgttcgagcctggcgatgctgacgcag
cagcaacacgtaccctcgcccgatgccctgttgctgcaggatcagggtcagcccctgccc
ctggcgctctacccggccgacagcccctaccggctgatcgacgaacagggccaggtcttc
agcggccgcctcgacgccgacgcccgcctgccggcgcagccgcagcccggctattaccag
ctggagatccgcgatacccgtcacgcgctggcggtcaccccggcggcgtgcctgtcggtg
tcgcagctgtgcggcaaaccgcgcatctgggggctcaccgcacagctttacgggctgcgc
cgcccaggcgatggcggcgtcggcgacacccaggcagtggccgagctgctgcggcatgcc
gccaaccagggcgccgatgccctggcactgagcccggtacacgcgctgttcgctgccgac
accgagcgtttcggcccctactcgccgtccagtcgtctgttcttcaaccccctgcatgcg
gcgcctgccgaccgcctgggtgaagaacgggtgcagcgcgccattcagacggccggtctg
caggaagaaatgcaacgtctggaacacctggagctgatcgactggcccgccgtggccaag
gcgcggcagcgcctgctgtggcagctgtatcaggacttttgccaggccccgggcgatctg
ctcgccgatttcgaggccttccgcgcagcaggcggcgacgccctgcagcagcattgctgt
ttcgaggccattcatgcgcagcgcctgcgcgaaggggccagcggcgactggcgcagctgg
ccgcaggaactgcgcaacccgctccagggcgccgtcacccgcttcgccgcggaacaggcc
gatacgctgaggtttcacgccttcgcccagtggctgatcgcccatggcctggaatgcgcc
caggccacggccagcggtgcgggcatgggcatcggcctgatcgccgatctggccgtgggc
gccgattgcgcgggcagccaggcctggtcacgccaggacgaactgctgccttcggtcacc
gtcggtgcgccgccggacatcatcaatcgccaggggcagaactggggcgtcgccgcgttc
tcgccgcaggggctgcaacggcacggctttcgcgcctacatcgaaatgctgcaggccaat
ctggcgcacgccggcggtatccgcatcgaccacgtgatggggctgcagcgcctgtgggtg
atcccgcagggcggcgaggcgcagcacggcgcctacctgcgctatccgctggacgacctg
ctgcgcctgttggcgctggagtcgcaccgccaccgcgccctggtcataggcgaggacctg
ggcaccgtccccgacgggctgcgcgagaagctggcggcgcgcaacatactcggcacccgc
gtgctgctgttcgaacagcaggacgggcgcttcatccccccggcacagtggtcgcgcaat
gccctggcgaccaccaccacgcacgatttgccgaccatcaagggctggttcgccggccac
gacatcgaatggcgggtgcgcgccgggcacgccgacgagcagagcctggagcaggaccat
gccgagcgggccggcgaacgggtggcgctgctgcaggcgctggaacagcgcggcccgctc
ggcggcaccgatgatgacgcctgcctgcaggcctgcatcgactacatcggcagcacgccc
tcggcgctcgccctgctgccgctggaagacgcctgcgcgctggagcagcagcccaacctg
cccggccccggcgacctgcaccccaactggcgacggcgctacccgctggcggccaacgaa
ctgctggaacagccggcgacccgccgccgtctggcctgtctggatacggcacgccgggag
gcaggcgatgagtga

DBGET integrated database retrieval system